KEGG   Aggregatibacter aphrophilus W10433: ADJ80_07790Help
Entry
ADJ80_07790       CDS       T04521                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aaz  Aggregatibacter aphrophilus W10433
Pathway
aaz00564  Glycerophospholipid metabolism
aaz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ADJ80_07790
Enzymes [BR:aaz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ADJ80_07790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 PRORP Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AKU63650
UniProt: A0A0K1N3K1
LinkDB All DBs
Position
1655578..1657170
Genome map
AA seq 530 aa AA seqDB search
MQRNTELEKVKNTEKWDFIVIGGGASGLGIALDAASRGYKTLLLEGYDFAKGTSSRSTKL
VHGGVRYLAAGDVALVKEALRERGRLSKNASHLFKNQNFIIPNYNFVDSVKYRIGLGLYD
YLSADLSLGKTIAINKDTTMQRLPTLNGTGLKNGVVYKDGQFDDSRLAINIAQTVVEQGG
TVLNYAKVVELLKDAQGKVNGVKFVDELNGEEFCVNGTAVINATGVFMNDILSMDHGTDK
KFVVPSQGVHLVLDKSFLPSDDALMIPKTSDGRVLFAVPWHERIVVGTTDTLMKEPSYEP
VALEQEIQFILDTAGQYLTKKPTRDDVLSIFAGLRPLAAPEKSGQSTKEVSRSHKVVVSD
SGLVTITGGKWTTYRQMSEDTVEEALKVHPQLAKKACVTTNLAIHGKIPAEQVDLRNHIY
IYGSDIPAIKALETENPEFAAKIHPRHPNTVAEVVWAVREEMAESVEDVLARRVRLLFLD
ARAAIDSAAKVANIMAKELNKDEQWERDQTAKFLDIAKHYLLVDYAPQVA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaatacagaacttgaaaaagttaaaaataccgaaaaatgggattttattgtt
atcggcggtggtgctagtggtttgggtattgcgttagacgcagcttcccgtggctataaa
actcttttattagaagggtatgactttgctaaaggtacatcaagtcgtagtacaaaatta
gtacacggtggtgttcgttatttggccgccggtgatgttgctttagtaaaagaagcctta
cgtgaacgtggtcgtttatcaaaaaatgcttcacatttatttaaaaatcaaaattttatt
attcctaattataattttgtagatagtgtgaaataccgcattggtttaggtctatatgat
tatttatccgctgatttaagtttgggtaaaacgattgcgattaataaagacaccacaatg
caacgtttgcctacgttaaatggcaccggcttgaaaaacggggttgtatacaaagacggc
cagtttgatgattcccgtttggcaattaacattgctcaaaccgtggttgagcaaggtggt
acagtattaaattacgccaaagtagttgaattattaaaagatgcccaaggcaaagttaac
ggcgttaagtttgttgatgaattaaatggtgaggaattctgcgtaaacggcacggcagta
attaatgctaccggtgtgtttatgaacgatattttatccatggatcacggtactgataaa
aaattcgtggtgccaagccaaggggttcaccttgttttagataaatctttcttgccaagt
gatgatgcattaatgattccaaaaacctccgatggtcgtgtgttgtttgccgtgccatgg
cacgaaagaattgtcgtaggaacaacagacaccttgatgaaagaaccttcttatgagccg
gttgccttggaacaagaaattcagttcattttggatactgctggccaatatttaacgaag
aaaccgacacgcgacgatgtgttgagtattttcgcaggtcttcgtccattggctgcaccg
gaaaaatctggtcaaagcactaaggaagtttctcgtagccataaagttgttgtaagtgat
agtggcttagtcacaatcacgggtggtaaatggacaacttatcgtcaaatgtccgaagat
actgttgaggaagccttgaaagtgcatccgcaattagcgaaaaaagcctgcgtcacaacg
aatttagccattcacggcaaaattccggcagagcaagtggatctaagaaatcatatttat
atttacggatccgacattcctgcaattaaagcattagaaaccgaaaatccggaatttgcc
gctaaaattcatcctcgccatccaaatactgttgctgaagtggtttgggctgtacgtgaa
gaaatggctgaatcggtggaagatgtattggcccgccgtgttcgcttgttgttcttagat
gctcgtgcagccattgatagtgccgcaaaagttgcaaatatcatggcaaaagaattgaat
aaagatgagcaatgggagcgtgatcaaacggcaaaattcttagatattgctaaacactat
ttacttgttgattacgcgccacaagtcgcctaa

DBGET integrated database retrieval system