KEGG   Candidatus Koribacter versatilis: Acid345_0499
Entry
Acid345_0499      CDS       T00352                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00970  Aminoacyl-tRNA biosynthesis
aba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acid345_0499
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_0499
Enzymes [BR:aba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Acid345_0499
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Acid345_0499
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_0499
SSDB
Motif
Pfam: Glu-tRNAGln ComZ
Other DBs
NCBI-ProteinID: ABF39504
UniProt: Q1IUE6
LinkDB
Position
613860..614186
AA seq 108 aa
MKVTEKDVKYVADLANLELTEAESKRFLKDLNSILEYIDNLNELDTTNVEPMAQVAARYG
GEGKSEAERYGYALRPDELRPSLPHDVAMKNAPDTDGTYFKVPKVIER
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaaagtcaccgaaaaagacgtaaagtacgtcgccgacctggcgaacctcgagcttacc
gaagccgagagcaagcgcttcctcaaggacctcaactcgatcctcgagtacatcgacaac
ctcaatgaactcgacaccaccaacgtcgaaccgatggcccaggtcgccgcgcgttatggg
ggcgaagggaagtccgaggccgagcgctacggctatgcccttcgtcccgatgaactccgc
ccgtcgttgcctcacgatgtcgcgatgaagaacgcgcccgatacagatggaacctacttc
aaggtacccaaggtaatcgaacgatga

DBGET integrated database retrieval system