KEGG   Candidatus Koribacter versatilis: Acid345_0680Help
Entry
Acid345_0680      CDS       T00352                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00380  Tryptophan metabolism
aba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Acid345_0680
Enzymes [BR:aba01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Acid345_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 DPRP
Motif
Other DBs
NCBI-ProteinID: ABF39685
UniProt: Q1ITW5
LinkDB All DBs
Position
complement(837127..838401)
Genome map
AA seq 424 aa AA seqDB search
MAAAAFDTTENFAIEMDARDPMSRFRGRFHIPPAPDGSASVYLVGHSLGLQPKTVRAYLE
QELKDWETLGVEGHFRGKHPWMPYHRLLTEQTARLVCAQPSEVVVMNSLTVNLHLMMVSF
YRPTRERHNILIEGSAFPSDQYAVQSQIKFHGFDPASSLLELCPRVGEATMRDEDILELI
EREGQSIALILLGGVNYATGQAFDMAEITKAGHAQGCVVAFDCAHAAGNLELKLHEWDVD
WAAWCSYKYLNGGPGCIGGCFVHERYARDFELPRFAGWWGHDQETRFKMGPEFHPMAGAE
GWQLSNPSILTMAALRASMEIFDEAGIGKLRQRSIALTGYLEFLLDQQKSARFEIITPRE
PERRGAQLSIRVAAGNRSVCDRLVEEGALCDWREPDILRVAPVPLYCSYRDCYRFVQRFV
ANLN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggcggccgctgcgttcgacaccaccgagaatttcgcaatcgaaatggatgcgcgcgat
ccgatgtcgcggtttcgcgggcggtttcatatcccaccggctccggatggatcggcgtct
gtgtatctggtggggcactcccttgggctgcagccgaagacggtacgggcatacctcgag
caggaattgaaggattgggagacgctcggtgtggaagggcattttcgcggaaagcatccg
tggatgccgtatcaccgactgctgacggaacagacggcgcgattggtatgcgcgcagccg
agcgaagtcgtggtgatgaattccctgacggtgaacctgcacctaatgatggtgtcgttt
tatcgacctacgagggagcggcacaacattctcatcgaaggcagtgccttcccgtcggac
cagtatgcggtacagtcgcagatcaagttccacggcttcgatccggcaagttcgttactc
gagctttgtccgcgagtaggcgaggcgacaatgagggatgaggacatcctcgagttgatc
gagcgtgaaggacagtcgatagcgctgatcttgcttggcggcgtgaattacgcgaccggg
caggccttcgacatggcggagatcacgaaggcgggtcacgcacaaggatgcgtggtggcg
ttcgactgcgcgcatgcagcgggaaatcttgagctcaagctacacgagtgggatgtggat
tgggccgcatggtgcagctacaagtacctgaacggcgggcccggctgtattggcggatgc
ttcgtgcacgagcgctacgcgcgcgacttcgagcttccgcggtttgcgggatggtgggga
cacgatcaggaaacgcgcttcaagatggggccagagtttcatccgatggcgggcgcggag
ggatggcagttgagcaatccatcgatcctgacgatggcggcactgcgagcgtcaatggaa
atcttcgatgaagcggggatcgggaagctgcggcagcggagcattgcgctcaccggatac
ctggagttcctgctcgatcagcagaagtcggcgaggttcgagatcatcacgcctcgggag
ccggagcggcgtggcgcgcagttgtcaattcgcgtcgcagccggcaatcgctcagtttgc
gacaggcttgtggaagaaggcgcgctctgcgattggcgcgaaccggatatcttgcgggtg
gcgccggtgccgctgtattgctcgtatcgggattgttatcggtttgtgcagcgatttgtg
gccaatctgaattaa

DBGET integrated database retrieval system