KEGG   Candidatus Koribacter versatilis: Acid345_1204
Entry
Acid345_1204      CDS       T00352                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acid345_1204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aba01007]
    Acid345_1204
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aba03016]
    Acid345_1204
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_1204
Enzymes [BR:aba01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Acid345_1204
Amino acid related enzymes [BR:aba01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Acid345_1204
Transfer RNA biogenesis [BR:aba03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Acid345_1204
 Prokaryotic type
   Other AARSs
    Acid345_1204
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_1204
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Other DBs
NCBI-ProteinID: ABF40207
UniProt: Q1ISE3
LinkDB
Position
complement(1487157..1488962)
AA seq 601 aa
MAKLDFLGELKRTHKCGELRAADANKNVVLMGWVNRRRDLGGLIFIDLRDRTGITQIVFD
NSNSELQAKAGDLRSEYCIAVIGTVAKREANTVNKNLPTGEIEVVAKEMRLFNDSKVLPF
SIADNSNVNEEVRLKYRYLDLRRPEMQANVQMRHDVTFAIRNYLASQNFLEVETPIMTRS
TPEGARDYLVPSRVHPGEFYALPQSPQIFKQILMISNCERYFQIARCFRDEDLRADRQPE
FTQIDLEMTFPTQDDVFGVVEGFLTAAWAAAGHKLEGKFPRMSYDDAIRQYGIDKPDLRL
PAMNDVKSAFAAENLQTLGIDLDLPVVCVRVPKIGELSRKERDDLKPMLNAKSGAKLFED
FKRLEKSFPEAAAKIKEIVKPEESDLLVVVAGAQRAEKASEIVTRNQSYAVYGAAGQVRL
AIAQKYSDRHGCFKKGEFKFLWVTDFPFFEWDENDKRWNAAHHPFTSCHEEDMGKLESDP
GGVRALAYDVVLNGTELGSGSIRIHRQDIQSIIFKSLGMGPEEQQQRFGFFLEALQYGTP
PHGGIALGLDRIVMILAGATSLREVITFPKTAAATDLMMDAPTPVSAEQLQQLNIKVTKR
E
NT seq 1806 nt   +upstreamnt  +downstreamnt
gtggcgaaactggattttctcggtgaactcaagcgtacgcacaagtgcggagaactccgc
gcggcggatgccaacaaaaacgtggtgctcatgggatgggtgaatcgtcgccgcgatctc
ggcgggctgatcttcatcgacctgcgcgaccgcacgggcattacgcagatcgtcttcgat
aattcgaattccgagctccaggcgaaggccggggacctgcgctccgaatactgcatcgca
gtgattggcacggtcgcgaagcgcgaggcgaacaccgtcaacaagaacctgccgaccggc
gagatcgaagtcgtcgcgaaagagatgcggctgttcaacgattcgaaggtgctgcccttc
tccattgccgacaattcgaacgtcaacgaagaggtgcggctgaagtatcgctacctcgac
ctgcggcggccggagatgcaggcgaacgtgcagatgcggcacgacgtgacttttgcgatc
cgcaactatcttgcgtcgcagaatttcctcgaggtcgaaacgccgatcatgacgcgctcg
actccagagggcgcgcgcgattatctcgttccgagccgcgtgcatccgggcgagttctat
gcgctgccgcagtcgccgcagatcttcaagcagattttgatgatctccaattgcgagcgc
tacttccagatcgcgcgctgcttccgcgacgaagacctgcgcgccgaccgccagccggaa
ttcacgcagatcgatttggagatgaccttcccgacacaggacgatgtgtttggcgtggtg
gagggctttctgactgcggcttgggcggcggcgggacacaagctcgaaggcaagttcccg
cgcatgtcgtacgacgacgcgattcggcagtatgggatcgacaagccagaccttcggctg
ccggcgatgaacgacgtgaaatcggccttcgcggctgagaacctgcaaacgctaggcatc
gatctcgatctgccggtggtgtgcgtgcgcgtgccgaagatcggcgagctttcgcgcaaa
gagcgcgacgacctgaaaccgatgctcaacgcgaagtcgggcgccaagctgtttgaagat
ttcaagcggctggagaaatcgttccccgaggctgcggcgaagatcaaggaaatcgtgaaa
ccggaagagagcgacctgctcgtcgtggtcgcgggcgcgcaacgtgcggagaaggccagc
gagatcgtgacgcgcaaccaatcctacgcggtgtatggagcggcgggacaggtgcggctg
gcgattgcgcagaagtattccgaccgccacggctgcttcaagaagggcgaattcaagttc
ctgtgggtcacggattttccgttcttcgaatgggacgagaacgacaaacgctggaacgcg
gcgcaccatccgtttacctcgtgccacgaagaagacatgggcaagctggaaagcgatccc
ggcggcgtgcgcgcgctggcttacgacgtggtgctgaacggcactgaactgggctcgggg
tcgatccgtattcaccggcaggacatccagagcatcatctttaagtcgctcgggatggga
cctgaagagcagcagcagcgcttcgggttcttcctggaagcgttgcagtacgggacgcct
ccgcacggcggcattgccttgggtctggaccgcatcgtgatgattctggcgggggcgacc
agcctgcgcgaagtgatcaccttcccgaaaacagcggctgcaacggacttgatgatggac
gcgccgacccccgtgagcgccgaacagttgcagcagttgaacatcaaagttacgaagcgg
gagtag

DBGET integrated database retrieval system