KEGG   Candidatus Koribacter versatilis: Acid345_1328
Entry
Acid345_1328      CDS       T00352                                 

Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acid345_1328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aba01007]
    Acid345_1328
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aba03016]
    Acid345_1328
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_1328
Enzymes [BR:aba01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     Acid345_1328
Amino acid related enzymes [BR:aba01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Acid345_1328
Transfer RNA biogenesis [BR:aba03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Acid345_1328
 Prokaryotic type
    Acid345_1328
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_1328
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1d DZR Zn-ribbon_8 DUF4609
Other DBs
NCBI-ProteinID: ABF40330
UniProt: Q1IS20
LinkDB
Position
1602517..1605087
AA seq 856 aa
MTDETQMTETPKAEERPDRYDPRAIEEKWTVQWANDPELYASEPDSAKKKFYVLEMLPYP
SGALHMGHVRNYAIGDALARFMWMTGHNVLHPMGWDAFGLPAENAAIKNQRQPREWTLGN
IEAMKKQMRRLGFAYDWSKEIATCLPDYYRWNQWFFIKFFEKNLAYKRKSKVNWCPECAT
VLANEQVVDGCCWRHETTRVEQRELEQWFFRITDYADELLRDLDQLEGWPEKVKTMQRNW
IGRSEGALVTFKLEQPSGPSGDSITVFTTRIDTIFGATSLQLAPEHPIVTDLIASNPDLL
SAVEDLKQQQRTAKEKGDIGAIEKHGVFTGAYAINPFNEEKVPIWIANYILTDYGTGAIM
SVPAHDERDYEFATKYGLEVRVVILPRRVGEPPEAGKPETNVLPYSGTDSLLINSGDFTG
LPVQEALEKMAKFAEEHGFGKATVTFRLKDWGISRQRYWGTPIPMLYCGKCGIVPVPEDQ
LPVLLPENVEITLAGGSPLTRVQEWLHTTCPKCGGPATRDTDTMDTFVDSSWYFYRYTNP
QLTTAPVDTKTIDYWFPIDQYIGGVEHAILHLIYSRFWTKVMRDLGLVHNSEPVTRLFTQ
GMVIKDGAKMSKNLGNVVAPDDMIAKYGADATRMYTLFAAPPDRDLDWQDAGVEGVSRFL
ARVYRLIAQNPIVHAGPAHYTLAELPANAKKIARKLHQTIKRISDELGGRWHFNTCVAAL
MEFVNECYAAPELFANPKEGIERTLVADVQRKVTLLLQPFAPYVAHELWAMLGEPSGLLR
APWPAFDASLAKEDEVEIVVQVNGKVRSKLVVSTDASEDEVKKLALADEKVQAAIAGKEI
VKVVVVPRKLVSIVVK
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgacagacgaaactcaaatgaccgaaactccgaaagccgaagagcgccctgatcgctac
gatccgcgggcgatcgaagagaagtggaccgtccagtgggcgaacgatcccgagctgtac
gccagcgagcccgatagcgcgaagaagaagttctacgtccttgagatgctgccctatccc
tccggcgctctccatatgggacacgtgcgcaactacgccatcggcgacgccctagcgcgt
ttcatgtggatgactggccacaacgtcctgcaccccatgggttgggacgccttcggcttg
cccgccgaaaacgcggcgatcaagaaccagcgccagccccgcgagtggacgcttggcaac
atcgaggcgatgaagaagcagatgcgccgcctcggcttcgcctacgactggtcgaaggaa
atcgcgacatgtttgcccgattactatcgctggaaccagtggttcttcatcaagttcttt
gagaagaacctcgcatacaagcgcaagagcaaggtgaactggtgccccgagtgcgccact
gtgctcgccaacgagcaggtggttgacggctgctgctggcgccatgaaaccacgcgcgtc
gagcagcgcgagttggagcaatggttcttccgcattaccgattacgccgacgaactcttg
cgcgatctcgaccagctcgaaggctggccggaaaaagtaaagacgatgcagcgcaactgg
attggccgcagcgaaggcgcacttgtcaccttcaagcttgagcaaccgtccggccccagc
ggcgacagcatcaccgttttcaccacccgcatcgacaccatctttggcgcgacctcgttg
cagttggcgcccgaacacccgatcgtcaccgacttgatcgcgagcaatcccgatttgctc
tctgccgtcgaagacctcaagcagcagcaacgcacggcaaaagaaaagggcgatatcggc
gccattgaaaagcacggcgtctttaccggcgcatatgccatcaatccgttcaatgaagag
aaggtgcccatctggatcgcgaactacatcctcacggattacggcaccggcgcgatcatg
agcgttccggcacatgacgaacgtgactacgaattcgccacgaaatacggcctcgaagtt
cgcgtcgtgatcttgccgcgccgcgtgggcgagccgcctgaggccggaaagcccgaaacc
aacgtgctgccctacagtggcaccgacagcttgctcatcaactccggcgacttcacgggc
ctgcccgtgcaggaagccttggagaagatggccaagttcgccgaagaacacggcttcggc
aaagccaccgtcaccttccgcctgaaggattggggcatcagtcgccagcgttactggggc
acgcccattcccatgctctattgcggcaagtgcggaattgtgccggtgccggaagatcag
ttgccggtgttgttgccggagaacgtggagatcaccctcgccggcggttcgccgctcacg
cgcgtgcaggagtggctgcacaccacgtgtccgaagtgcggtggccccgccacgcgcgac
accgacaccatggacacgttcgtcgattcgtcctggtacttctatcgctataccaatccg
cagctcaccactgcgccggtggataccaagacgattgattactggttcccaatcgatcag
tacattggcggcgtcgagcacgcgatcttgcatttgatttactcgcgcttctggacgaag
gtcatgcgcgacttgggattggtgcacaacagcgagccggtcacgcgcctgttcacgcag
ggcatggtgatcaaagacggcgcgaagatgtcgaagaacctcggcaacgttgtcgcgccg
gatgacatgatcgcgaagtacggcgctgacgcgacgcgcatgtacacgttgttcgccgcg
ccacccgatcgcgatctcgattggcaggatgccggcgtcgagggcgtgagccgcttcctc
gcgcgcgtctatcgcttgatcgcgcagaaccccattgttcatgcgggccccgcgcactac
acgcttgccgagcttccagctaacgcaaagaagatcgcgcgcaaattacatcagacgatc
aagagaatttcggatgagcttggagggcggtggcacttcaatacttgcgtggcggcactc
atggaatttgtgaacgagtgctatgccgcgccggagttgtttgccaatccgaaagaggga
atcgagcgcacgttggttgcggatgtgcagcgcaaagtcacgttgctgttgcagccgttc
gcgccgtacgtggcgcatgagttgtgggcgatgctcggtgaaccttcgggattgttgaga
gcgccgtggcccgcatttgacgcgagtttggcgaaggaagatgaagttgagatcgtggtg
caagtgaacggaaaagttcgtagcaagctggtggtttcgacggatgcttcagaagacgaa
gtgaagaagctggcgctggcggatgaaaaagttcaggcggcgattgctgggaaagagatt
gtgaaggtcgtggtggttccgcggaagctggtcagtatcgtggtgaagtag

DBGET integrated database retrieval system