KEGG   Candidatus Koribacter versatilis: Acid345_1743Help
Entry
Acid345_1743      CDS       T00352                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00040  Pentose and glucuronate interconversions
aba00051  Fructose and mannose metabolism
aba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid345_1743
   00051 Fructose and mannose metabolism
    Acid345_1743
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Acid345_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc FAD_binding_2 2-Hacid_dh_C ADH_zinc_N_2 PrmA AlaDh_PNT_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ABF40744
UniProt: Q1IQV6
LinkDB All DBs
Position
2115301..2116425
Genome map
AA seq 374 aa AA seqDB search
MSTATQIGNEKDEAIPASMKAAVYHGLNDVRLETVPVPEIGRGEVLIRVASCGICGTDLK
KISTGSHSAPRIFGHETAGVIAAAGDGVTKFQVGDRVLAFHHIPCQECYYCRHKVFAQCP
TYKKVGVTAGYEPSGGGFSEYVRVMDWIVDRGGVVKLPDHVSYDLATFVEPVNTCQKAIE
TMALKSGETVLVIGQGAIGMILAFLAQRAGATVITSDLFPQRLTIGESLGLKNGIDANQT
DVVAHMRDLTEGRGADASILAVPVNGLIRTAMDAVRPGGRVMLFAHTQRTEAKFDPSAVC
MDEKTLLGSYSASVDLQKDSVDFVFSREMDLEKLISHRFPLEQAVEALQLAARPQPDSLK
IMIEPRMAWEGQAK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgcgacacaaattggcaatgagaaggatgaggcgattcccgcttcgatgaaa
gctgcggtgtaccacggcctcaatgatgtccgcctcgagactgtaccggtgcccgagatc
gggcgtggggaagtgctcatccgggttgcgtcttgcggtatttgcggcaccgacctaaag
aagatctcgacgggttcccattccgcgccccgcatttttggccacgagactgccggagtc
attgctgcagctggcgacggcgtgacaaagtttcaagtcggcgatcgcgttctcgccttc
caccacatcccatgccaggagtgctactactgtcgacacaaagtgtttgcgcagtgtccg
acatacaaaaaggtcggggtcacggcaggctacgaaccaagcggtgggggattctccgag
tatgtgcgagtaatggactggatcgtggatcggggcggcgtagtgaaactccctgatcat
gtttcgtatgacctcgcaaccttcgtggagccggtgaacacctgccagaaggctattgaa
acgatggcgcttaagtctggggaaacggtgttggtgatcggccaaggtgcaattggcatg
atcttggcgttcctggcacaaagggccggagcaacggtgattacctccgatttgttccca
cagaggcttacaataggagagtctctggggctgaaaaacgggatagatgccaatcagaca
gacgttgtggcccatatgcgcgaccttacggaaggacgcggtgccgatgcgtcgattttg
gcggttccggtgaacggcttgatccgcacggctatggacgcggtccggcccggcggtaga
gtgatgttatttgcgcacactcagcgcacggaggcgaagttcgacccttccgcggtgtgt
atggatgagaaaacgctgctgggttcgtatagcgcttcagtagatttacagaaagattcg
gtagattttgtattcagccgcgagatggacctggaaaagttgatctcgcatcgcttcccg
ctggagcaggcggtggaagctttgcagttggcggcgcgcccgcaaccggattcgctcaag
atcatgatcgaacctcgtatggcgtgggaaggacaggcgaagtga

DBGET integrated database retrieval system