KEGG   Candidatus Koribacter versatilis: Acid345_2872
Entry
Acid345_2872      CDS       T00352                                 

Definition
(GenBank) SSU ribosomal protein S16P
  KO
K02959  small subunit ribosomal protein S16
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Acid345_2872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aba03011]
    Acid345_2872
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_2872
Ribosome [BR:aba03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Acid345_2872
  Bacteria
    Acid345_2872
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_2872
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: ABF41873
UniProt: Q1IMM7
LinkDB
Position
3417577..3417831
AA seq 84 aa
MLMIRLSRRGARKQPHYRIVVIEKDRARDGRSVEVVGTYNPRTNPGSIELKRERVEYWVS
KGAQMSDRVKKLWDKTPAAPASVA
NT seq 255 nt   +upstreamnt  +downstreamnt
gtgttgatgattcgtctctcgcgccgtggcgcgcgtaagcaaccccattaccgcattgtc
gttatcgagaaggaccgcgcccgcgatggccgctccgttgaggtggttggcacctacaac
ccgcgcacgaaccccggttccatcgaactgaagcgtgagcgcgtggaatactgggtcagc
aaaggcgcccagatgagcgatcgcgtgaagaagctgtgggacaaaactcctgccgctccg
gccagcgtagcgtaa

DBGET integrated database retrieval system