KEGG   Candidatus Koribacter versatilis: Acid345_3069
Entry
Acid345_3069      CDS       T00352                                 

Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acid345_3069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aba01007]
    Acid345_3069
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aba03016]
    Acid345_3069
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_3069
Enzymes [BR:aba01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Acid345_3069
Amino acid related enzymes [BR:aba01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Acid345_3069
Transfer RNA biogenesis [BR:aba03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Acid345_3069
 Prokaryotic type
    Acid345_3069
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_3069
SSDB
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C
Other DBs
NCBI-ProteinID: ABF42070
UniProt: Q1IM30
LinkDB
Position
3647573..3648814
AA seq 413 aa
MPNFAPVEEQLAYLKKGSAEIIRESDLRERLEKSRQSGKPLRVKAGFDPTAPDLHLGHTV
LMRKLKHFQDLGHTVIFLIGDFTSLIGDPTGRIATRPPLTREQIDQNAETYKAQVFKILD
GAKTEVRFNSEWLGKLDYEKLIRLTAKFTVSQMLERDDFHKRYTDEKPIAMHEFLYPVAQ
AYDSVCLEADVELGGTDQKFNLLMGRELQRHYNQPSQIVLTMPLLEGTDGVQKMSKSYGN
YIGITEAPEEMFGKVMSISDALMWRYYELLTDVKTEEIEALKAKVAAGEAHPMKVKQDLG
KIIIRDFHNAEAAEHAAENWSKQFQKKEVPDELEEVALTAADIGLDGGTSVRLDRVLAKA
GLADSMTDAGRKIKVGAVRIDSEVASAPHLTIAGLPASWVIRVGKRMKRVTVS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgccaaatttcgcacctgtagaagaacaactcgcctacctgaagaagggctctgccgaa
atcatccgcgagagcgacctccgcgaacgcctcgaaaagtcgcgccaaagcggcaaaccg
ctgcgcgtgaaagccggcttcgaccccacggcccccgatctccacctcggccataccgtg
ctgatgcgcaagctaaagcactttcaggacctcggccacaccgtcattttcctgatcggc
gacttcactagccttatcggagaccccaccggccgcatcgcgacccgtccgccgctcacc
cgcgagcagatcgaccagaacgccgaaacctacaaagcccaggtcttcaagattctcgac
ggcgccaagaccgaagtccgcttcaacagcgaatggctcggcaaactcgactacgaaaag
ctcatccgcctcaccgcgaagttcaccgtctcgcagatgctcgagcgcgacgacttccat
aagcgctacacagacgagaagcccatcgccatgcacgagttcctctaccccgtggcgcag
gcctacgactccgtttgcctcgaagccgacgtcgaactcggcggcaccgaccagaaattc
aacctgctcatgggccgcgaactgcagcgccactacaaccagcccagccagatcgtcctc
accatgccgctgctcgaaggcaccgacggcgtgcagaagatgtcgaagagctacggcaac
tacatcggcatcactgaagccccggaagaaatgttcggcaaggtcatgtccatcagcgac
gcgttgatgtggcgctactacgaactcctcaccgatgtgaagaccgaagagatcgaagcg
ctcaaagcgaaagtcgcagctggcgaagcccaccccatgaaggtgaagcaggacctcggc
aaaatcatcattagagacttccacaacgccgaagccgccgaacacgcggcagaaaactgg
tcgaagcaatttcagaaaaaagaagtgccggacgagttggaagaagtcgcgctcaccgca
gccgacatcggtctcgacggcggcaccagtgtccgcctcgaccgcgttctggcaaaagca
ggcctggccgattccatgacggacgccggccgcaaaatcaaagtcggcgctgtgagaata
gacagcgaagttgcctccgccccgcacctgaccatcgccggcctccctgcaagttgggta
attcgcgtaggaaaacgcatgaagcgcgtaaccgtgagctag

DBGET integrated database retrieval system