KEGG   Candidatus Koribacter versatilis: Acid345_3110Help
Entry
Acid345_3110      CDS       T00352                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01130  Biosynthesis of antibiotics
aba01230  Biosynthesis of amino acids
Module
aba_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acid345_3110
Enzymes [BR:aba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Acid345_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB IGPS PGM_PMM_II
Motif
Other DBs
NCBI-ProteinID: ABF42111
UniProt: Q1ILY9
LinkDB All DBs
Position
3695932..3696954
Genome map
AA seq 340 aa AA seqDB search
MSSAATESEINHVIDRVKELGYQAHVTRGTEKTIVAAVGSSGNREQLAALEAAPGVENVV
VIAHPFKLVSMQVKQKRTVVNVGGVPIGGEACVLMAGPCSVESREQLMTVAHAIAAAGAT
MLRGGAYKPRTSPYEFQGLGTEALKLLREASEATGLPVVTEVMSTEDVDLVAEYADMLQV
GARNMQNFSLLRRLAKCERPILLKRAPSATVKDWLLAAEYLLAGGNSQVVLCERGIRSYD
PDMRNTFDLAAIALAKQLSHLPVVADPSHGTGRRDLVPIMARAAVAVGADGVIVEVHPCP
EKALSDGPQSLTLPEFEKMVQLLGQPLRRHLRQELKAATA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgcagccacagaatcggaaatcaaccacgtgatcgaccgggtgaaagagctc
ggctaccaggcgcacgtaacgcgtggcaccgagaagacgatcgtcgccgccgttgggagt
tccggcaaccgcgaacaactggcggcgctggaggccgcgccgggcgtggagaacgtggtc
gtcatcgcgcacccattcaagctcgtcagtatgcaggtgaaacagaaacggaccgtggtg
aacgtgggcggcgtgccgattggcggtgaggcttgcgtgcttatggcggggccgtgctcg
gtggagtcgcgagagcaattgatgaccgtggcccatgcgatcgcggcggccggggcaacg
atgctgcgcggcggcgcatataagccgcggacctcgccgtacgagttccaggggctgggg
acggaggcgctgaagctgctgcgcgaagcgtccgaggcaacgggtctgccggtcgtcaca
gaagtgatgagcaccgaggatgtggacctggtggcggagtacgcggacatgctgcaggtg
ggcgcgcgcaatatgcagaatttctcgctgctgcgacgattggcgaaatgcgagcggccg
attttgctgaagcgggcgccgtcggcaacagtgaaggattggctgctggcggcggagtat
ctgctggcgggcggcaatagccaggtggtgctgtgcgagcgcgggattcgctcgtacgat
cccgacatgcgaaacacgttcgacctggcggcgattgcgctggcgaaacagttgtcgcac
ttgccggttgtcgccgatccgtcgcatgggaccggacgacgcgatctggtgccgatcatg
gcgcgcgcggcggtggcggttggcgcggatggcgtgatcgtcgaagtgcatccgtgcccg
gagaaggcgctgtcggacggaccgcaatcgctgaccctgccggagttcgagaagatggtg
cagttgctggggcagccgctgcgtaggcatctgcggcaggaattgaaggcggcgacagcg
tag

DBGET integrated database retrieval system