KEGG   Candidatus Koribacter versatilis: Acid345_3279Help
Entry
Acid345_3279      CDS       T00352                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00061  Fatty acid biosynthesis
aba00780  Biotin metabolism
aba01100  Metabolic pathways
aba01130  Biosynthesis of antibiotics
aba01212  Fatty acid metabolism
Module
aba_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Acid345_3279
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Acid345_3279
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Acid345_3279
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aba01004]
    Acid345_3279
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Acid345_3279
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Acid345_3279
Lipid biosynthesis proteins [BR:aba01004]
 Fatty acid synthase
  Component type
   Acid345_3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase NRDD
Motif
Other DBs
NCBI-ProteinID: ABF42280
UniProt: Q1ILH0
LinkDB All DBs
Position
3884729..3885499
Genome map
AA seq 256 aa AA seqDB search
MGNSLEGQTAVVFGVANKRSIAWAIAQKLQSEGARLAITYQNDRLRQEAEDMIHALPNAE
GFQCDVSSDAEIEQLFATLKDKYGKIDHVVHSVAYAPAEDLKGRFKDTSREGFRIAHDVS
CYSLIAISRAAQPLMTEGGSIVTLTYYGSTRVVPYYNIMGVAKAALECTVRYLAYDLGGN
NIRVNAISAGPIKTLAARGIGSFGEILKEVNEKAPLKRNIDQNEVADTAAFLCTRGARGI
TGETIYVDAGINIMAF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaactcactggaaggtcagacggccgtagttttcggcgtagccaataagcgcagc
atcgcgtgggccatagcccagaagctgcaatccgagggcgcgcgactcgccattacgtat
caaaacgatcgcctgcgccaggaagccgaagacatgatccacgccctccccaacgccgag
ggcttccagtgcgacgtctccagcgacgccgaaatcgaacagctcttcgccacgcttaaa
gacaaatacgggaagatcgaccacgtcgtccacagcgttgcctacgcgcccgccgaagat
ctcaagggccgcttcaaagacaccagccgcgaaggcttccgcatcgcccacgacgtgagc
tgctactcgctgatcgctatctcccgtgccgcgcagccgcttatgaccgaaggcggcagc
atcgtgacactgacctactacggttcgactcgcgtggtgccgtactacaacatcatgggc
gtggcaaaggccgcgctcgagtgcacggtgcgctatctcgcctacgatcttggggggaac
aatatccgcgtgaacgccatctccgccgggccgatcaaaacgctcgcggcgcgaggcata
ggcagctttggagaaattctgaaagaagtgaacgagaaggcgccattaaagcgcaatatc
gatcagaacgaggtcgccgacaccgctgctttcctctgcacccgcggggcgcgcgggatt
accggcgaaacgatctacgtggacgcagggattaatattatggcgttctag

DBGET integrated database retrieval system