KEGG   Candidatus Koribacter versatilis: Acid345_3535
Entry
Acid345_3535      CDS       T00352                                 

Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aba03009]
    Acid345_3535
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_3535
Ribosome biogenesis [BR:aba03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Acid345_3535
 Prokaryotic type
  GTPases
   Acid345_3535
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_3535
SSDB
Motif
Pfam: MMR_HSR1 KH_2 Dynamin_N FeoB_N GTP_EFTU AIG1 RsgA_GTPase PduV-EutP cobW MMR_HSR1_Xtn Arf ABC_tran Gtr1_RagA Ras AAA_22 AAA_18 AAA_23 SRPRB AAA_29 ATP_bind_1 Roc
Other DBs
NCBI-ProteinID: ABF42536
UniProt: Q1IKR4
LinkDB
Position
complement(4181981..4182955)
AA seq 324 aa
MPFRSGFVSIIGRPNAGKSTLLNALVGEKIAIVTHKPQTTRNRIQGIVTVPKKGQIVLVD
TPGVHKPDKTLNKRMMQEVYDALEGCDLLLYIHDVTHKFEKEDEYTLSLVKKTGQPVMLL
LNKIDLIAKPKLLEIITQFSTLHDFKEIIPISAAKGSGLDILRKKVLQSLPVGPHYFPDD
QITDQPERFLAAEIIREQVLVCAHQEVPYATTVMVEQWEEKRSLTKIAAAIFVERDGQKA
IIIGRGGESLKRIGTNARRELEKILNTKVFLELFVKVQAGWRDSRHFVDQLDWHRQLEEL
STSLIPDRDAINPKGHVPGGRRKH
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcccttccgctcgggatttgtctccattatcggccgaccgaacgcaggcaagagcacg
ctgctgaatgcgctcgtgggcgagaagatcgccatcgttacccacaagccgcagaccacg
cgcaatcgcatccagggcatcgttacggtgccaaagaaagggcagatcgttctcgtcgat
acgcctggtgttcacaagccagacaagacgctgaacaagcgcatgatgcaggaagtttat
gacgccctcgaaggctgcgacctgctgctctacatccacgacgtaacccacaagttcgag
aaggaagacgagtacacgctgtcgctggtgaagaagactggccagccggtgatgctgctg
ctgaacaagatcgatctcatcgccaagccgaagctgctggagatcatcacgcagttctcg
acgctgcacgacttcaaagagatcattccgatctccgcggcgaagggcagtggtctcgac
atcctgcgcaagaaagtcctgcagagccttcccgtcggcccgcactattttccggacgac
cagatcaccgatcagccggagcgcttcctggcggcggagatcatccgcgaacaagtgctg
gtctgcgcgcaccaggaagttccctatgcgacgacggtgatggtggagcagtgggaagag
aagcggagcctcaccaagattgcagcggccattttcgtcgagcgcgacgggcagaaggca
atcatcatcgggcgcggcggcgagtccttgaaacgcattggaacgaatgcgcggcgcgag
ttggagaagatcctgaacacgaaggttttcctcgaactcttcgtgaaggtccaagcgggc
tggcgcgactctcggcacttcgtggaccaactcgattggcaccggcaactcgaagagctg
agcaccagcttgatcccagatcgtgacgcgataaaccctaaaggtcatgtaccaggtggc
cgacgcaagcactag

DBGET integrated database retrieval system