KEGG   Candidatus Koribacter versatilis: Acid345_4144
Entry
Acid345_4144      CDS       T00352                                 

Definition
(GenBank) LSU ribosomal protein L32P
  KO
K02911  large subunit ribosomal protein L32
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Acid345_4144
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aba03011]
    Acid345_4144
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_4144
Ribosome [BR:aba03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Acid345_4144
  Bacteria
    Acid345_4144
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_4144
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-ProteinID: ABF43144
UniProt: Q1IJ06
LinkDB
Position
4904456..4904644
AA seq 62 aa
MPNPKRRHSKARTGNRRAHDHLSAHSLSECPNCHWKKMPHRACAKCGYYKGREVLEVEDN
KK
NT seq 189 nt   +upstreamnt  +downstreamnt
atgcctaatccaaaacggcgacactcaaaagctcgcaccggcaaccgccgtgcccacgat
cacctgtcggcccactcgctctccgagtgcccgaactgccactggaagaagatgccacat
cgcgcctgcgcgaagtgcgggtattacaaaggccgcgaagttctcgaagtcgaagacaac
aagaagtag

DBGET integrated database retrieval system