KEGG   Candidatus Koribacter versatilis: Acid345_4537
Entry
Acid345_4537      CDS       T00352                                 

Definition
(GenBank) SSU ribosomal protein S6P
  KO
K02990  small subunit ribosomal protein S6
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Acid345_4537
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aba03011]
    Acid345_4537
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_4537
Ribosome [BR:aba03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Acid345_4537
  Bacteria
    Acid345_4537
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_4537
SSDB
Motif
Pfam: Ribosomal_S6 DUF4988
Other DBs
NCBI-ProteinID: ABF43537
UniProt: Q1IHW3
LinkDB
Position
complement(5381871..5382314)
AA seq 147 aa
MQRTYEVMFIVRPDLTDEDLDKLVSTLETQVGTAGGTIKSVDKMGKRRLAYEVSTFTDGM
YILFTIEGEGALIKEVERRLRVQEQVIKFITVRVDEEQKRLAKVKAIRDTKVRGKGTRAA
EQAAAAEAAAPAAAPAEPASAEPAPAV
NT seq 444 nt   +upstreamnt  +downstreamnt
atgcagcgtacgtatgaagtgatgttcatcgttcggccggatctgaccgacgaggacctg
gacaagctagtttccactctggagacgcaggtgggcacggcgggtggcacgattaagtct
gtcgacaagatgggcaagcgccgcttggcgtatgaagtcagcacgttcacggacgggatg
tacatcctgttcacgattgaaggcgaaggcgcgctgattaaagaagtcgagcgccgcctg
cgcgttcaggaacaggtgattaagttcatcaccgtgcgcgtggacgaagagcagaagcgt
ttggcgaaggtgaaggcgatccgcgacacgaaggttcgtggcaagggtacgcgagcggcc
gagcaggctgcagcggcggaagcggctgcaccggcagcggctccggctgagccggcgagt
gcggaaccggcgccggctgtctag

DBGET integrated database retrieval system