KEGG   Candidatus Koribacter versatilis: Acid345_4716Help
Entry
Acid345_4716      CDS       T00352                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00970  Aminoacyl-tRNA biosynthesis
aba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acid345_4716
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aba03029]
    Acid345_4716
Enzymes [BR:aba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Acid345_4716
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Acid345_4716
Mitochondrial biogenesis [BR:aba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acid345_4716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF4410
Motif
Other DBs
NCBI-ProteinID: ABF43715
UniProt: Q1IHD5
LinkDB All DBs
Position
complement(5578885..5580360)
Genome map
AA seq 491 aa AA seqDB search
MATTPITLATVLEKYEPVIGLEVHVQLLTATKAFCGCSTQFGAPPNTNVCPVCLGMPGAL
PVLNRKAVEFAVLAATALNCQVRERSIFARKNYFYPDLPKGYQISQFDKPLAEHGYIDIK
TAAGPKKIGITRLHMEDDAGKSLHDGLPDSADKSSVDLNRSGTPLIEIVSEPDIRSADEA
YEYLTNLKEIILYTGVSDCNMEEGSLRCDANVSIRPKGQEQFGTKAEVKNVNSFRFIKQA
LDYEILRQFEVLESGGQVKQETRLYNSNEGRTYSMRSKEQAHDYRYFPEPDLLPLVVDTK
WRDEIVSTLPELPEARRKRMIAEYGITDGDAHTLTLTRTMADQFESAAKQAKNPKRVANL
VQGELIGRLKAKGLEIEQSPISMNGVAMSADLVEAGTISGKMLKDLYDLAFERGEDFPAI
YEKEKPQQISDTGALEKIIDEVIAANPKQLEQYRAGKKTVIGFFVGQVMKASKGAANPAL
VNELLTKKLEG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacgccgatcacgctagcgactgtcctcgagaagtacgagcctgtcattggg
ctcgaggttcacgttcagctcctcaccgccaccaaggctttctgcggatgctccacccaa
ttcggagcgccgccgaataccaacgtctgcccggtttgcctcggcatgcccggcgcgttg
ccggtgctgaaccgcaaggccgtcgagttcgcggtgctggccgctaccgcgctcaattgc
caggttcgcgagcgctccatcttcgcgcgtaagaactacttctatcccgatctgccgaag
ggctaccagatctcccagttcgacaagccgcttgccgagcacggctatatcgacatcaag
accgccgctggcccgaagaagatcggcatcacgcgtctgcacatggaagacgacgccggt
aagagcctgcatgacggtcttcccgacagcgccgacaagtcctcggtcgatctcaaccgc
tccggcacgccgctgatcgagatcgtcagcgagcccgacatccgctctgccgacgaggcc
tacgagtacctcacgaacctgaaggagatcatcctttacaccggtgtgagcgactgcaac
atggaagaaggctcgctacgctgcgacgccaacgtctccattcgccccaagggccaggaa
cagttcggaaccaaagccgaagtcaagaacgtgaactcgttccgcttcatcaagcaggcg
ctggattacgaaatcctccgtcagttcgaggtgctcgagtccggtgggcaggtgaagcag
gagacgcgcctctacaactccaacgaaggccgaacgtactccatgcgctcgaaagagcag
gcgcacgactaccgctacttccccgagcccgacctgcttccgctcgttgtagatacgaag
tggcgcgatgagatcgtcagcactttgcccgaacttcccgaagcgcgccggaagcggatg
atcgcggaatacggcatcacggacggcgacgcccacacgctcaccctcactcgcaccatg
gccgaccagtttgagtctgcggctaagcaggccaagaaccccaagcgcgtcgcgaacctc
gtgcagggcgaactcatcggccgcctcaaggccaaaggcttggagattgaacagtcgccg
atctcgatgaatggcgtggcgatgtcggccgatctagttgaagcaggcacgatcagcggc
aaaatgctgaaggatctctacgacctcgcattcgagcgcggcgaagatttccccgcgatc
tacgagaaagagaagccacagcagatctcggataccggcgcgctggagaagatcatcgac
gaagtcatcgccgcgaatccgaagcagctcgagcagtaccgcgcaggcaagaagaccgtc
atcggcttcttcgtcggccaggtgatgaaggcgtcgaagggtgcggccaatcccgcgctc
gtgaatgagctgctgacgaagaagttggaagggtaa

DBGET integrated database retrieval system