KEGG   Acinetobacter baumannii AB031: IX88_01455Help
Entry
IX88_01455        CDS       T03376                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00473  D-Alanine metabolism
abaa00550  Peptidoglycan biosynthesis
abaa01100  Metabolic pathways
abaa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IX88_01455
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IX88_01455
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    IX88_01455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaa01011]
    IX88_01455
Enzymes [BR:abaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IX88_01455
Peptidoglycan biosynthesis and degradation proteins [BR:abaa01011]
 Precursor biosynthesis
  Amino acid ligase
   IX88_01455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD RimK GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AIL73891
UniProt: V5V8X3
LinkDB All DBs
Structure
PDB: 

Position
complement(292308..293234)
Genome map
AA seq 308 aa AA seqDB search
MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDR
AFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRII
TKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWIT
GREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRNDVEYGIPCGLSETEEKKLQALCL
RAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAIL
EQTLEGTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatgctacaaaattcggcaaagttgccgtgttacttggtgggaaatcggctgag
cgtgctgtgtctttagatagtggtcaggcagttttggacgctttgttacgttcaggtgtt
caggctgaggcatttgatccgcaagaccgtagcgtaactgaacttgtaaactatgatcgt
gcatttattgtattgcatggtcgtggtggcgaagacggtcaaatccaaggtgtgcttgag
tggttgaacatcccttatacaggaacgggtgtacaaggttctgccattggtatggataaa
gtcaaaaccaagcaaatctggcaaggaagtgatttaccaactgcaccgtatcgcattatt
actaaagaaactgacttggattcagtgattgctgaattggggttgcctgtcattatcaag
cctgtacatgaaggttcaagtgtaggcatgagtaaagttgagaaagctgaagattttgcg
gcagcaattgaaaaggcaactcagcacgatgctgtagttatggcagaaaaatggattaca
ggacgcgaatttacgatttcattcttaaatggtcagcctttaccagttattcgtttgcag
ccaccagcagatgttgctttctatgactacgaagcaaaatatcaacgtaatgatgttgag
tatggcattccttgtggtcttagcgaaactgaagagaaaaaactacaagctctatgttta
cgcgctttccaggctgtaggtgcagaaggctggggacgtattgatgcaatgcaggatgag
caaggtaacttctggcttttagaagtaaatactgtgccaggcatgaccagtcattcgctt
gtaccaaaggctgctaaagcagtaggttatagctttgatgaattgtgtgttgcaattctt
gagcaaacattggaaggtacggcttaa

DBGET integrated database retrieval system