KEGG   Acinetobacter baumannii AB031: IX88_06350
Entry
IX88_06350        CDS       T03376                                 

Definition
(GenBank) thioredoxin reductase
Organism
abaa  Acinetobacter baumannii AB031
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 FAD_oxidored FAD_binding_2 GIDA HI0933_like K_oxygenase NAD_binding_8 NAD_binding_7 Thi4 FMO-like Staph_opine_DH
Other DBs
NCBI-ProteinID: AIL74809
UniProt: A0A204EJE0
LinkDB
Position
complement(1318669..1319616)
AA seq 315 aa
MSARHSRLIILGSGPAGYSAAVYAARANLKPTLIAGLQLGGQLTTTTEVDNWPGDPEGLT
GPVLMDRMQAHAERFGTELVYDHINEVDLNVRPFVLKGDMDEYTCDALIIATGATAQYLG
LESEQKFMGQGVSACATCDGFFYKNQNVMVVGGGNTAVEEALYLSNIAEHVTLVHRRDSL
RSEKILQDHLFAKEKEGKISIVWNHEVEEVLGDNTGVTGVRLKSTKDDSKQEVQVQGLFI
AIGHKPNTSMFEGQLNLRDGYIQIQSGTSGNATATSVAGVFAAGDVADSIYRQAITSAGS
GCMAALDAEKYLDNL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagtgctcgtcattctcggttaattattctcggttctggccctgcgggttatagtgca
gctgtttatgcagcacgtgcaaatcttaaaccaacacttattgcaggtttacagcttggc
ggccaacttacaacaacaaccgaagttgacaactggccgggcgatcctgaaggtttgact
ggtcctgtcctaatggaccgtatgcaagcacatgctgaacgctttggtactgaacttgtc
tacgatcatattaatgaagtggacttaaatgtacgtccttttgttcttaaaggtgatatg
gatgagtacacttgtgatgctttaattattgcaactggtgcgacagctcaatatcttggc
ttagagtctgaacaaaaatttatgggtcaaggcgtgagcgcatgtgcaacatgtgatggc
ttcttctacaagaaccaaaatgtgatggttgttggtggtggtaatactgctgttgaagaa
gcactttatttatcaaatattgctgaacatgtgacacttgtacaccgccgcgattcttta
cgctctgagaagattttacaagatcacttatttgctaaagaaaaagaaggcaaaatcagt
atcgtttggaaccatgaggttgaagaagttcttggtgacaatactggcgtaacaggtgtt
cgcttaaaatctacgaaagatgacagcaaacaagaagtacaagttcaaggcttattcatt
gcaattggccataaaccaaatacctctatgtttgaaggtcagctaaacttacgtgatggc
tatatccaaatacaaagtggtacttcaggtaacgcaacagcgacttctgtagcaggcgtt
tttgctgctggtgatgttgctgatagtatttatcgtcaagcgattacttcggcgggttca
ggctgtatggctgcactagatgccgaaaaatatctagataacctttaa

DBGET integrated database retrieval system