KEGG   Acinetobacter baumannii AB031: IX88_07120Help
Entry
IX88_07120        CDS       T03376                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00550  Peptidoglycan biosynthesis
abaa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IX88_07120
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    IX88_07120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaa01011]
    IX88_07120
Enzymes [BR:abaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IX88_07120
Peptidoglycan biosynthesis and degradation proteins [BR:abaa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   IX88_07120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Stimulus_sens_1
Motif
Other DBs
NCBI-ProteinID: AIL74956
UniProt: G1C6Y0
LinkDB All DBs
Position
complement(1487975..1489993)
Genome map
AA seq 672 aa AA seqDB search
MKQHFPLKDIQQEKRIYRGRIFFAVGLVIICLLVLASRYAYLQIFHYDEFSTASDKNRIR
LQPLPPARGYIYDRNGVLLADNYPVFTATLSKADVENVDTVIEQLQPILELTQEDVDRFK
SRIKTARKTERVAIKLNLTETNIAKFSEVKYKFPGVRIETQMTRYYPHGDLFAHVIGYVG
RINDKELKSIDKDLYAGTNLIGKIGVEKSYEDLLHGTPGYESVEADAHSNILRHLGRKDP
TRGNDLYLSLDYGLQVVASQQLAGRRGAIVAIDPRTGEILALVSSPSFNPNLFVTGINHK
DYSSLRDNIDQPLYNRAVQGVYPPGSTIKPMEAMGGLHYGIVDWATAISDPGYFHLPGDS
HKFRDWKKTGHGIVNMHKAIIMSCDTYFYILANQMGIDQMNQWMRQFGFGQKTGVDLPSE
SEGLYPNPEWKMRTRKSKWMKGETISVSIGQGAFTATPLQLAMATAITANHGSHVVPHVL
RATHGAKPFTVRNAPDGKINFNGTDEDWVKMREAMIDVIQSGTGRGIRTPLYQIAGKTGT
AQVKSIAQGKRYNEAALSERQLDHGLFVGFAPADKPEIAIAVIWENGRHGGSAAQLAKPV
FDYWLLTRKKNPIRPANHQVNGGLMTAGIKPGELPSGNESASSTPATSAPTSAAASTPQA
TPTRAATNEVDE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcactttcctttaaaagatatccagcaagaaaagcgcatttatcgaggtcgt
atattttttgccgtagggcttgtgattatctgtttattggtactagccagccgatacgct
tatctacaaatttttcattatgatgagttctcgacggcatcggataaaaaccgtattcgc
ctacaaccccttccacctgctcgtggttatatttatgaccgcaatggggttttactggca
gataactaccctgtttttaccgcaacattaagtaaagcagatgttgagaacgttgatacc
gttattgaacaattacagcctattttagaactcactcaagaagatgtagatcgttttaaa
agccgcattaaaacagcacgtaaaactgaacgtgtggccattaaactgaatttgaccgag
acaaatattgccaagtttagtgaagttaaatacaagttccccggggttagaattgaaacc
caaatgacgcgctattatccacatggtgatttatttgctcacgtgattggatatgttggc
cgtattaacgataaagaattaaaaagtattgataaagatttatacgctggaacaaacctg
attggtaaaattggtgtagaaaaaagctatgaagatttacttcatggaacacctggttat
gagtctgtagaagcagatgctcatagtaatattttgcgtcacttaggtcgtaaagaccca
acccgtggtaatgatctctacttatcattagattatggtttgcaagttgtcgcgtcgcaa
caactcgctggtcgacgtggagcaattgttgcgatagacccacgcactggtgaaattctt
gcgttggtttcaagcccaagctttaaccctaacttatttgtaacgggtattaatcataaa
gattatagctctctacgtgacaatatagatcagcctctttataaccgtgcagtacaaggt
gtataccctcctggttcaaccattaagccaatggaagcgatgggcggtttacattatgga
attgtcgattgggctaccgctatttccgaccctggctatttccatttaccgggtgactca
cacaaatttcgtgactggaaaaaaactggtcatggtatcgtgaacatgcacaaagccatt
atcatgtcttgtgatacctatttttatattttggctaatcaaatgggcatcgatcagatg
aaccaatggatgcgccaatttggctttggccaaaaaacaggtgtcgatttaccaagtgaa
agtgaaggcttatatccaaatcctgaatggaaaatgcgtacacgcaaatccaaatggatg
aaaggtgaaacgatttcagtcagtattggtcagggtgcatttaccgcaacccctttacaa
ctcgccatggcaactgccattacggcgaaccacggctcacatgtagttccacatgtttta
cgtgcaacgcatggtgcaaaaccttttaccgtacgtaatgcacctgatggaaaaattaat
ttcaatggtacagatgaagattgggtaaaaatgcgagaagccatgattgatgtaattcaa
tcaggtactggtcgtggtatccgtacaccgctatatcaaattgccggaaaaacaggtaca
gcacaggttaaaagtattgctcaaggcaaacgttataacgaagctgcgcttagtgaacgc
caacttgaccatggtctttttgttggctttgctccggctgataaaccagaaatcgctatt
gcagttatttgggaaaatggccgtcatggtggttcagcagcccaacttgctaaacccgtg
tttgattactggttattaacccgtaagaaaaatccgattcgaccagccaaccatcaggtt
aatggtggcttgatgaccgctggaattaaaccgggtgaactcccaagtggtaatgaaagt
gccagctcaactcctgcgacctctgctccgacttccgcagcagcctctactccacaggca
acaccaactcgtgctgctacaaacgaggtcgatgaataa

DBGET integrated database retrieval system