KEGG   Acinetobacter baumannii AB031: IX88_07755Help
Entry
IX88_07755        CDS       T03376                                 

Definition
(GenBank) 5-dehydro-4-deoxyglucarate dehydratase
  KO
K01707  5-dehydro-4-deoxyglucarate dehydratase [EC:4.2.1.41]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00053  Ascorbate and aldarate metabolism
abaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    IX88_07755
Enzymes [BR:abaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.41  5-dehydro-4-deoxyglucarate dehydratase
     IX88_07755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AIL75070
LinkDB All DBs
Position
1630472..1631383
Genome map
AA seq 303 aa AA seqDB search
MDALELKNIISDGLLSFPVTDFDQNGDFNKSSYAKRLEWLAPYGASALFAAGGTGEFFSL
TGNEYSEVIKTAVDTCKGSVPIIAGAGGPTRQAIEQAREAERLGAHGILLMPHYLTEASQ
EGLIEHVKQVCNSVDFGVIFYNRSVSRLNLDSIQKLAEMCPNLIGFKDSSGQIDMMTAVT
QTMGDRLSYLGGLPTAEVFAAPYKALGCPVYSSAVFNFIPKTAMEFYNALRSDDFETTNR
LIKDFFLPLIKIRDRKSGYAVSMIKAGAKIVGHDAGPVRPPLSDLTQADYEDLAALIATL
GPQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatgctcttgagttaaaaaacattatttctgatggtttactgtctttcccggtaaca
gatttcgatcaaaacggagattttaataaatcttcttatgcaaaacgtcttgagtggtta
gctccatacggcgccagtgctttatttgctgcaggtggtacaggtgagtttttctcatta
actggcaatgaatattctgaagtaattaaaactgcggtagatacatgcaaaggcagtgta
ccgattattgctggggcaggtggtccgacacgtcaggcgattgaacaggcaagagaagca
gagcgcttaggtgcacacggtattttgttaatgccgcattacttaactgaagcaagccaa
gaaggtttaattgaacacgttaagcaagtatgtaactcagtagactttggtgtaattttt
tataaccgtagcgtatcaagattaaatctcgattcaatccaaaagttagccgagatgtgc
ccgaacttaatcggttttaaagacagctctggtcaaatcgatatgatgacagcagtgact
cagactatgggggatcgtttgtcgtatttaggtggcttgccgacagcagaagtttttgca
gcgccatataaagctttaggttgcccagtttactcgtcagctgtatttaactttattcca
aagactgctatggagttttataacgcgcttcgcagtgatgactttgaaacaaccaatcgt
ttgattaaagatttcttcttgccactgattaaaattcgcgaccgtaaatcaggttatgcg
gtaagcatgattaaagcaggtgccaaaattgttgggcatgatgcaggccctgtgcgtcca
ccattaagtgatttaactcaagcagactatgaagatttggctgctctcattgcgacactt
ggtccgcaataa

DBGET integrated database retrieval system