KEGG   Acinetobacter baumannii AB031: IX88_10480Help
Entry
IX88_10480        CDS       T03376                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IX88_10480
Enzymes [BR:abaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     IX88_10480
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     IX88_10480
    1.1.1.-  
     IX88_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIL75599
LinkDB All DBs
Position
2204652..2205710
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINFEPFITQRIQLDDLISQGFETLIHNNESAVKIIVQP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggtgatatccgtattgaagatattcctgaacca
gaagtcactcccggcactgtaggcattaaggtagcctggtgtggaatctgtggtacagat
ttgcacgaatttatggaaggaccaatttttattccaccgtgtggacatccgcaccctatt
tcaggtgaatctgcgccaattaccatgggacatgaattttcaggtgtagtctatgccgta
ggtgaaggtgttgatgatattgaaattggccagcatgtagtcgtagagccttatattgtg
gccgatgatgtgccgactggaccgggcgataattatcatctttccaaaaatatgaacttt
attggtttaggcggtcgtggcggtggcttatcggagaaaattgcggttaaacgccgttgg
gtgcatccaatttccaataaaattccactggatcaggcggccttaattgaaccgttatcg
gtaggtcatcatgcctatgtgcgcagtggtgcaaaggctggtgacattgcactggttggc
ggtgcgggtccaataggtttgttgctttcggcaattttaaaagcgaaaggtcttaaggtc
atcattaccgaactaagtgccaaacgtaaagaaaaagccaaagagtcgggagtcgcagat
tatattttagacccgtcagaagtggatgttgtttctgaggtcatgaaaattactaatggc
gatggtgttgatgttgcatttgaatgtagtagcgttaacaaagtattagatactttggtt
gcggcagtgaaaccaacaggcgttatagttattgtttcgatttggagccatccagcatca
attaatgtgcatagtgtggtaatgaaagagcttgatgtaagaggcacaatagcctacgta
aatgaccatcaagaaacgattaaactggtcgaagaaggtaaaataaattttgaacctttt
attacgcagcgtattcaacttgatgatttgatttcacaaggttttgaaaccttaattcac
aacaatgagtcagccgttaagattattgtacaaccctaa

DBGET integrated database retrieval system