KEGG   Acinetobacter baumannii AB031: IX88_10515Help
Entry
IX88_10515        CDS       T03376                                 

Definition
(GenBank) multidrug DMT transporter permease
Organism
abaa  Acinetobacter baumannii AB031
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA Deltameth_res
Motif
Other DBs
NCBI-ProteinID: AIL75606
LinkDB All DBs
Position
complement(2212694..2213611)
Genome map
AA seq 305 aa AA seqDB search
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALK
DHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFA
PAALLGLSGIVLLFWHDLINSQFNAQLLMGIGLCAIGTYGFSLGNMISVRHQKRGLNIFS
TNCYAMTYGALVMLILALFIGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAFFSLVGRIGA
AKAAYSTLLFPLVALTVSTFFEGYEWTLNAVFGILLILLGNYLMFSKFEIGKKLFSSQKN
CEKQA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttactctatgttgcggtggtgttgatttggggaacaacatggattggaatt
gccgttcaaagccattatgcaacacccgttgtcgcaattttatggcgttttgctatttca
gccttattactttgggttgttttactattttcaggaaaattacagcgaattgctttaaaa
gatcatttgttctgtatgctgcaaggcctttgcgttttcggactaaactttatttgtttt
tatactgcggttaaatatgtaaatagcggtttagagtctgtcattttttcgatggccgtt
ttctttaatgccattaatgcgcttatcttttttaagcagaagccttccccaaactttgca
ccagctgcacttttgggcctaagtggtattgttttactgttttggcatgacctgattaat
agccagtttaatgcgcagttattaatgggtattgggctatgtgcaataggcacttacggt
ttttctttagggaacatgattagtgttagacaccaaaaacgtggtctaaatatcttttca
acaaactgttatgccatgacttacggcgcattggtgatgttaattctggctttatttata
ggacaagatttaatgccgccgatgaatttcccattcttaagctcggtactatacttagct
gtatttggtacggttattgggttttcagcttttttttctctagtcggacgaattggcgca
gccaaagcagcctatagcacgttgctctttcctttagttgctttaacagtttctactttc
tttgaaggatatgagtggactttaaatgctgtatttggaattttactcatcttacttggt
aactacttaatgtttagtaagtttgaaattggaaagaagttatttagcagtcaaaaaaat
tgtgagaagcaggcataa

DBGET integrated database retrieval system