KEGG   Acinetobacter baumannii AB031: IX88_10545
Entry
IX88_10545        CDS       T03376                                 

Definition
(GenBank) oxidoreductase
Organism
abaa  Acinetobacter baumannii AB031
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like FAD_oxidored DAO GIDA Trp_halogenase Lycopene_cycl NAD_binding_8 Pyr_redox_3
Other DBs
NCBI-ProteinID: AIL75612
LinkDB
Position
2218175..2219908
AA seq 577 aa
METKYLEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAV
IPGYATPEQYTKEITIANDGVVNQTTVYAYAKHSFTTIQQLDQWGIKFEKDETGEFAVKK
VHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSG
DFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQI
NPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKV
DHLAEETIQTIEEILHTNERPSRGRFHEGRGTNYRQDMVEMHISEIGFCSGHSASGVWVN
EKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVNAVEDSELNQSEIEAEKA
RIFAPLNCSEGLPPEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIKRISARNP
HELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEHG
NMVSFKKPIEPYVVPINQDEAVSYDRLRIQKDVALAD
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggaaactaaatatcttgagttcgatattgtggtgattggtggtggaactgctgggcca
atggctgcgattaaagcaaaacaagaaaacccgaatttaaaagtcttgctcattgaaaaa
gcgaatgtaaagcgcagtggggcgatttcaatgggaatggatgggctgaataatgctgtc
attccgggctatgcaacacctgagcaatacaccaaagaaattaccattgctaatgatggg
gtagttaaccaaaccactgtatatgcatatgcaaagcatagttttacaaccattcaacaa
ctcgatcaatggggtattaagtttgaaaaagatgagacaggcgaatttgcagtaaaaaaa
gtacatcacatgggtgcatatgttttaccaatgcccgaaggccatgacgttaaaaaagtt
ttatatcgtcagttaaagcgtgctcaagtcaaaattaataatcgcattgtcaccacaaag
cttttaaaaaatgagcaaggtgcaatcaatggtgtactcggttttgattgtcgtagtggt
gacttttatgtcattaaaacgaaagctgccattttatgttgtggtgccgcagggcgttta
ggtttgccagcttccggctatttaatgggcacttatgaaaacccaaccaatgcaggtgac
ggctatgcaatggcataccatgcaggtgctgagcttgctaacttagaatgcttccagatt
aatccattgattaaagactataacggtccggcttgtgcctatgtgactggtcctttagga
ggttataccgctaacagtaaaggtgaacgtttcattgaatgtgactactggagtggtcaa
atgatgtgggagttttaccaagaactggaaagtggtaatggtcctgtttatttaaaagta
gatcatctggccgaagaaaccattcaaaccatcgaagaaatcttgcataccaatgagcgc
ccaagccgtggacgttttcatgagggccgaggaaccaattaccgtcaagatatggtggaa
atgcatatttcagaaattggtttctgtagcgggcacagcgcttctggcgtatgggtcaat
gaaaaagctgagacttcagttaaaggattatacagtgctggcgatatggcggctgtacct
cataactatatgcttggtgcatttacctacggatggtttgcgggtgtaaatgccgcgcaa
tacgtgaatgcagttgaagatagtgaattaaaccaaagcgaaatagaagcagaaaaagct
cgaatatttgcgccactaaattgctcagaaggtttacctccagagcaagtggaatataag
ctgcgccgttttgtaaatgactatttgcagccccctaaaactcgccaaaaaatggaaatt
gggctcaagcgttttgaagaaatcaaacaagatattaagcgaatttctgccagaaaccca
catgagctgatgcgtgccgctgaagtttcttttattcgagattgtgcggaaatggcagct
agagcttcactgtttagagaggaaagccgctggggactgtaccactatagagcagatttc
cctcaaaaaaataactcggattggttctgtcacgcgcatttgaaaaaagatgaacacggc
aatatggtcagtttcaaaaagccaatcgagccttatgtggttccgattaatcaagatgaa
gctgtgtcgtatgaccgtttacgcattcaaaaagatgttgctctagcagactaa

DBGET integrated database retrieval system