KEGG   Acinetobacter baumannii AB031: IX88_16685
Entry
IX88_16685        CDS       T03376                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00010  Glycolysis / Gluconeogenesis
abaa00020  Citrate cycle (TCA cycle)
abaa00260  Glycine, serine and threonine metabolism
abaa00280  Valine, leucine and isoleucine degradation
abaa00310  Lysine degradation
abaa00380  Tryptophan metabolism
abaa00620  Pyruvate metabolism
abaa00630  Glyoxylate and dicarboxylate metabolism
abaa00640  Propanoate metabolism
abaa01100  Metabolic pathways
abaa01110  Biosynthesis of secondary metabolites
abaa01120  Microbial metabolism in diverse environments
abaa01200  Carbon metabolism
Module
abaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abaa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IX88_16685
   00020 Citrate cycle (TCA cycle)
    IX88_16685
   00620 Pyruvate metabolism
    IX88_16685
   00630 Glyoxylate and dicarboxylate metabolism
    IX88_16685
   00640 Propanoate metabolism
    IX88_16685
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IX88_16685
   00280 Valine, leucine and isoleucine degradation
    IX88_16685
   00310 Lysine degradation
    IX88_16685
   00380 Tryptophan metabolism
    IX88_16685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abaa04147]
    IX88_16685
Enzymes [BR:abaa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     IX88_16685
Exosome [BR:abaa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   IX88_16685
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA AlaDh_PNT_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_3 3HCDH_N DAO Thi4 FAD_binding_3 2-Hacid_dh_C Lycopene_cycl
Other DBs
NCBI-ProteinID: AIL76774
UniProt: A0A077GKK9
LinkDB
Structure
PDB: 
6BZ0

Position
complement(3474359..3475792)
AA seq 477 aa
MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALL
DSSHRYEDTVHHLADHGITTGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGT
GKLLAGKKVEFVPHEGETQILEPKYVILASGSVPVNIPVAPVDQDIIVDSTGALNFPEVP
KRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILTKQGLDIRI
GAKVSGTEVNGREVTVKYTQAGEDKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLV
EVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHP
EAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIG
PAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAIQRKRK
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtctcaacaatttgatcttgttgtcattggcggtggtcctggtggttatgaagctgcg
attcgcgctgctcaactaggcttcaaagtcgcttgtattgaaaaacgtattcacaacggt
aagccttctttaggtggtacttgcttaaacgtaggttgtatcccttctaaagctttgctt
gattcttctcatcgttatgaagatacagtgcatcatttagctgatcacggtattacaact
ggtgaagtgaatttcgatcttgcaaaacttcttgctcgtaaagacaaaattgttgaccaa
ttaactggcggtattgatcaattgcttaaaggcaacggtatcgagtggttaaaaggtaca
ggtaaattacttgctggtaaaaaagttgagtttgttccacatgaaggtgaaactcaaatt
ttagaacctaaatacgtaattcttgcgtctggttctgtgcctgtaaatattcctgtagct
cctgtagatcaagatattattgttgattcaactggcgcattaaacttccctgaagtacct
aagcgtttaggtgtaattggtgcaggtgtaatcggtttagaacttggttcagtatggcgt
cgtcttggtgcagaagttgttgtatttgaagcaatggatgcattcttgccaatggctgat
aaagcactttctaaggaatatcaaaaaatcttgactaaacaaggtttagatatccgcatt
ggtgcaaaagtatctggtactgaagtaaacggtcgtgaagtgactgttaaatacactcaa
gctggtgaagacaaagaacaaacgtttgataagttaatcgtttgtgttggccgtaaagct
tatgctgaaggtttattagctgaagattcaggtattaaattaactgaacgtggtttagtt
gaagtaaatgatcactgtgcaacttctgtagaaggtgtatatgcgattggtgacttagtg
cgcggtccaatgcttgctcataaagcaatggaagagggcgtaatggctgttgaacgtatc
cacggtcatgcagctcaagtaaactatgacacaatcatttctgttatctatacacaccct
gaagcggcgtgggttggtttaactgaagagcaagctaaagaaaaaggtcatgaagtaaaa
actggtcaattcggttttgctgtaaatggtcgtgctttagctgctggtgaaggtgcaggt
tttgttaagtttgttgctgatgcaaaaactgaccgtttattaggtatgcatgtgattggg
cctgcggcatctgatatcgttcaccaaggtatgatcgcacttgaatttgtatcttctgtt
gaagatcttcagttgatgacttttggtcacccaacattctctgaagttgttcatgaagct
gcacttgctgtagatggtcgtgcaattcacgcgattcaacgtaagcgtaaataa

DBGET integrated database retrieval system