KEGG   Acinetobacter baumannii AB031: IX88_16700Help
Entry
IX88_16700        CDS       T03376                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00020  Citrate cycle (TCA cycle)
abaa00190  Oxidative phosphorylation
abaa00650  Butanoate metabolism
abaa01100  Metabolic pathways
abaa01110  Biosynthesis of secondary metabolites
abaa01120  Microbial metabolism in diverse environments
abaa01130  Biosynthesis of antibiotics
abaa01200  Carbon metabolism
Module
abaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IX88_16700 (sdhB)
   00650 Butanoate metabolism
    IX88_16700 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IX88_16700 (sdhB)
Enzymes [BR:abaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IX88_16700 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     IX88_16700 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AIL76777
UniProt: V5VAD3
LinkDB All DBs
Position
complement(3480462..3481172)
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALKVQDETLTFRRSCREG
ICGSDGVNINGKNGLACLQNLNDLPEKIVIRPLPGLPVVKDLVVDMNQFYDQYDKIQPFL
INNQPAPPKERLQSPEEREHLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFI
IDSRDTATAERLARLDDPFSLFRCKGIMNCVSVCPKGLNPTKAIGHIRNMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtactcgtacattcgaaatctaccgctatgatcctgataaggataaagcg
ccgtacatgcaaactttcaagcttgaattgactgataagcaccgtatgttgcttgatgca
ttgcttgctttgaaggttcaagacgaaacgttaacattccgtcgttcttgccgtgaaggt
atttgtggttctgatggtgtgaatatcaatggtaaaaatggtttggcttgcttgcaaaac
cttaacgatttaccagagaaaatcgtaattcgtccattacctggtttgccggttgttaaa
gatttggttgttgatatgaaccaattctatgatcagtatgacaaaattcagccattcttg
atcaataaccaacctgctccacctaaagagcgtttgcaatctcctgaagagcgtgaacac
ttaaatggtttgtatgagtgtattctttgtgcatgttgttcaacttcatgcccatcattc
tggtggaaccctgataaattcttgggtccttcagcgttgttgaatgcatatcgttttatt
atcgactctcgtgatactgcaactgcagaacgtttggctcgtcttgacgatccgttcagt
ttgttccgttgtaaaggtattatgaactgtgtgtcagtatgtcctaaaggtttgaatcca
acaaaagcaatcggtcatatccgtaatatgttgttagatcaagcgggttaa

DBGET integrated database retrieval system