KEGG   Acinetobacter baumannii AB031: IX88_16705Help
Entry
IX88_16705        CDS       T03376                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
abaa  Acinetobacter baumannii AB031
Pathway
abaa00020  Citrate cycle (TCA cycle)
abaa00190  Oxidative phosphorylation
abaa00650  Butanoate metabolism
abaa01100  Metabolic pathways
abaa01110  Biosynthesis of secondary metabolites
abaa01120  Microbial metabolism in diverse environments
abaa01130  Biosynthesis of antibiotics
abaa01200  Carbon metabolism
Module
abaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IX88_16705
   00650 Butanoate metabolism
    IX88_16705
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IX88_16705
Enzymes [BR:abaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IX88_16705
    1.3.5.4  fumarate reductase (quinol)
     IX88_16705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AIL76778
UniProt: V5VBX8
LinkDB All DBs
Position
complement(3481187..3483022)
Genome map
AA seq 611 aa AA seqDB search
MGAINPKEDYSNIQNLTFDAVIVGGGGSGMRASYQLAQAGLKVAVLTKVFPTRSHTVAAQ
GGIGASLGNMQEDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHLGMPFDRNA
DGTIYQRPFGGHSANYGDKPVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLI
RNEAGDVLGVTAIDQETGNIAVFQAKATLFATGGAGRVYRASTNAYINTGDGLGMAARAG
IPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEPFMERYAPTLKDLAPRDFVS
RSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVFEIGKKFANVDITKEPIPVVP
TIHYQMGGIPTNMHGQVCLPEPGTDNYTKPVKGFYAIGECSCVSVHGANRLGTNSLLDLV
VFGKAAGEHIIDYVTKHHGDEYAPLPTNVLEQTLARVRKLDESTSGENAQEVADAIRDIV
QDHAGVFRTQALLDKGVKEILALEPRVRNIHLKDKSKVFNTARVEALEVENLYEVAKATL
ISAAARKECRGAHTVVDYELPADHPTYSYGRRDDEWMKHTLWYSSDNRLEYKPVRFKPLT
VDPIPPAPRTF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgataaaccctaaagaagattattcaaatattcaaaacctcactttcgatgct
gttatcgttggtggtggtggttctggtatgcgtgcatcttaccaacttgctcaagcaggt
ttgaaagttgcagtacttactaaagttttcccaacacgttcacatacagttgctgctcag
ggcggtattggtgcgtcgttaggtaacatgcaagaagataactggcatttccacttttac
gatacagtaaaaggttctgactggttaggtgaccaagacgcaatcgaatttatgtgtcgt
gaggcgccaaaagttgtttatgaacttgaacacttaggtatgccgttcgaccgtaacgct
gatggtacaatttaccaacgtccgttcggtggtcactctgcaaactatggtgataagcca
gttccacgtgcttgtgctgctgctgaccgtactggtcacgctttattgcacacgctttat
caaagcaacgtgaaaatgggtactcaattcttcgttgagtggatcgctcttgatttgatc
cgtaacgaagcaggtgatgtactcggtgtaactgcaattgaccaagaaactggtaacatt
gcagtattccaagcaaaagcaacattatttgcaactggtggtgctggtcgtgtttaccgt
gcatcaacaaatgcttatatcaacactggtgacggtcttggtatggctgctcgtgctggt
attccattacaagatatggaattctggcaattccaccctacaggtgttgcgggcgcaggc
gtattgttgactgaaggttgtcgtggtgaaggtgcgatccttcgtaacaaagacggcgaa
cctttcatggaacgttatgcaccaactttaaaagacttggctccgcgtgacttcgtatca
cgttctatggaccaagaaattaaagaaggtcgtggttgtggtccaaaaggtgattatatc
ttgcttgatatgactcacttgggtgctgacacaattatgaagcgtttaccatctgtattt
gagattggtaaaaaattcgcaaacgtggacatcactaaagaaccaattccagtagtacca
acaatccattatcaaatgggtggtattcctacgaatatgcatggtcaagtgtgcttacca
gagcctggtacagacaactacactaaacctgtaaaaggtttctatgcaatcggtgagtgt
tcatgcgtatcagtacatggtgcgaaccgtttaggtactaactcacttcttgacttggtt
gtatttggtaaggctgctggtgagcacattatcgattacgtaactaagcatcatggtgat
gaatatgcaccgcttccaacaaatgtattagagcaaactttagctcgtgtacgtaaattg
gatgaatcaacttctggcgaaaatgctcaagaagttgctgatgcaattcgtgatattgtt
caagaccacgcaggtgtattccgtactcaagcattgcttgataaaggtgttaaagagatt
cttgctcttgaaccacgcgtgcgtaacattcacttgaaagataaatctaaagtatttaac
actgcacgtgttgaagcgcttgaagttgaaaacttatatgaagttgcaaaagctacatta
atttcagctgctgcgcgtaaagaatgtcgtggtgcgcatacggtagttgattatgaatta
ccagctgatcacccaacttattcatacggtcgccgtgatgatgagtggatgaaacacact
ttatggtattcatcagataaccgtttggaatataagccagtgcgcttcaagccgttaact
gttgatccaattccaccagcaccacgtacattctaa

DBGET integrated database retrieval system