KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_00145Help
Entry
BJAB0715_00145    CDS       T02727                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00473  D-Alanine metabolism
abab01100  Metabolic pathways
abab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abab00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJAB0715_00145
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BJAB0715_00145
Enzymes [BR:abab01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BJAB0715_00145
Peptidoglycan biosynthesis and degradation proteins [BR:abab01011]
 Precursor biosynthesis
  Racemase
   BJAB0715_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGQ04791
LinkDB All DBs
Position
159368..160471
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
LDEAKRIRALGWTGPILLLEGIFSPQDLFDCVQYQLSFTIHSEAQIEWVEKHPYPAQFDV
FLKMNSGMNRLGFKPQHYVQAWERLNNLANVAKITHMMHFSDADGDRFGQQGIDYQITAF
EEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSPDYPTHSITDWGLQPTMSL
RSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGYQRISPTGTPVLVDSVRTRT
VGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLSIDDVAVSSGTVGYELMCAVTAR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtgattcaccgtcaagccttacaaaataacttggcggtg
gtacgcaaggctatgccaaacagtaaggtctttgccgttgtcaaagccaatgcttatgga
catggaattgaacgtgtttatgaagcatttaaagcagcagatggctttgccttactggat
cttgatgaagcaaaacgaattcgtgctctaggttggacgggtccgattttgttgctcgaa
gggattttttctcctcaagatttatttgattgtgtgcagtatcagcttagtttcaccatt
catagtgaagcgcaaatcgagtgggtagaaaagcatccttaccctgctcaatttgatgtt
tttttgaaaatgaacagtggtatgaaccgtcttggttttaaaccacagcattatgtgcag
gcttgggaacgtttaaataatttggcaaatgtcgccaagattacccacatgatgcatttt
tcggatgcagatggtgatcgtttcggtcagcaaggtattgattatcaaattactgccttt
gaagaaattgtgaaggatttaccgggtgaaagatcggtaagtaatagtgcggcaattctg
cgttatcaagaccagctcaaatcagattatgtccgtagcggcatcatgctttatggcagc
tcgccagattacccaacgcatagtattacggattggggcttgcagccgaccatgagctta
cgtagtgaaattatttccgttcagcatttggagccgaatgaaagcgtaggttatggctca
aactttgtcgcagagcaacccatgacgattgggattgtggcttgcggctatgccgatggt
tatcaacgtatttcgccaacaggtactccagttttagtggactcagtacgcacgcgtaca
gttggccgcgtcagtatggatatgttggcagtcgatttaacgggtattgagagtgccaaa
gttggtagtgaagtggtgctctggggtcagtcaagtacaggcgtcgttctatctattgac
gatgttgcagtttcatccggtacggtgggttatgaactgatgtgtgccgtcaccgcccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system