KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01556Help
Entry
BJAB0715_01556    CDS       T02727                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00473  D-Alanine metabolism
abab01100  Metabolic pathways
abab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJAB0715_01556
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BJAB0715_01556
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abab01011]
    BJAB0715_01556
Enzymes [BR:abab01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BJAB0715_01556
Peptidoglycan biosynthesis and degradation proteins [BR:abab01011]
 Precursor biosynthesis
  Racemase
   BJAB0715_01556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4454
Motif
Other DBs
NCBI-ProteinID: AGQ06202
LinkDB All DBs
Position
complement(1633082..1634374)
Genome map
AA seq 430 aa AA seqDB search
MKLKTNFSHLAYSCALVLFGSMQFAYAAPLLTSHITNEVSPAPTANAWIEVDTQAFEDNI
KRTNQLLNGKTQLCVVMKANAYGHSIDLLMPSVMKLNVSCIGITSNAEAAMVRKHGYKGK
ITRLRTATDSEIINAHALNIEELLGNYDQATRISKWAEANNTNVHYSLALNSGGMDRNGL
EISTAQGKEQAVAITKLPNLKIDGIMTHYAVEDEKYVRERLAQFNEQTAWLIKKAKLNRK
ELTLHTANSFATVNVPESHLDMVRAGAIIYGDFPNHPEYKRMMAFKTQIAAVNNYLKGST
VGYDQTYTLTRDSKLANLPVGYSDGYRRSFSNKAFVLVNGQKAPVVGRVSMNTVMVDVTD
IPEAKAGDEVVLFGRQGNAEVQSSDLTSLTGHILTEAYTPWSNSNPQVIKPIRSPEQVIL
TNSKVAATAE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaaacaaatttttcgcatctcgcttatagctgtgcattggtattattcggt
tccatgcaatttgcctatgctgcacctttactcacgtctcatatcacaaatgaagtcagc
cctgcacctacagcaaatgcatggattgaagttgacactcaagcttttgaagataatatt
aaaaggacaaatcaattacttaatggcaaaacacaactttgtgtagtcatgaaagcaaat
gcatatgggcatagtattgacctacttatgccgagtgtgatgaagttaaacgtatcttgt
attggcatcaccagtaatgcagaagcagcgatggtgcgtaagcatggctataaaggcaaa
attacacgtttacgtacagcaactgatagtgaaattatcaatgcacatgcgttaaatatt
gaagagcttttgggtaattatgatcaggctacccgtatctctaaatgggcagaagcgaac
aatacaaatgttcattatagcttggctttaaattcgggtggtatggatcgtaatggcctt
gaaatctctacagctcaaggtaaagaacaagctgttgcaatcactaagcttccaaatctt
aaaattgacggcattatgacccattatgctgtagaagatgaaaaatatgttcgtgagcgc
ctagctcaatttaatgaacaaacagcatggttgattaaaaaagccaaactaaatcgtaaa
gaattaacattacatacagcaaattcatttgctaccgtaaatgttcctgaatcacattta
gatatggtccgtgcaggcgcaattatttatggagattttcctaatcacccagaatataaa
cgcatgatggcatttaaaacacaaattgctgccgttaataattaccttaaaggttcaact
gtaggttatgaccaaacttatacgttgacacgtgactccaaacttgcaaacctgcctgtc
ggttattcggatggctaccgtcgtagttttagtaataaagcttttgtcttagtcaatgga
caaaaagcgccagtggttggtcgagtatcaatgaatactgttatggttgatgtaacagat
attccagaagccaaagcgggcgatgaagttgtattatttggacgtcaaggcaatgctgag
gttcaatctagtgatttaacgagtcttacaggccatattttgacagaggcctatactcca
tggagtaactctaatccacaagtgattaaacctattcgatctccagaacaagtgatatta
accaatagtaaagttgcagcaaccgctgagtaa

DBGET integrated database retrieval system