KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_02750Help
Entry
BJAB0715_02750    CDS       T02727                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abab  Acinetobacter baumannii BJAB0715
Brite
Enzymes [BR:abab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BJAB0715_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGQ07396
LinkDB All DBs
Position
2832606..2833232
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLENLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatc
agtaaagaaactttagaataccatcacgacaaacatcacaatacctatgttgttaactta
aacaacttaatcaaaggtactgaccttgaaggtaaaactttagaagaaatcattaaagca
actgctggtgatgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccac
actttctactggaacagcatgaagccaaacggtggtggtaagcctactggcgcaatcgct
gctaaaattgatgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacacgcttactacatcgatttccgcaacttacgtcctaaa
tacatcgcaactttcttagaaaaccttgtgaactgggactatgcaaatgcaaaacttgca
ggccaaccagctggtgtagagaaataa

DBGET integrated database retrieval system