KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_02845Help
Entry
BJAB0715_02845    CDS       T02727                                 

Definition
(GenBank) Fatty acid desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00591  Linoleic acid metabolism
abab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    BJAB0715_02845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abab01004]
    BJAB0715_02845
Enzymes [BR:abab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     BJAB0715_02845
Lipid biosynthesis proteins [BR:abab01004]
 Desaturase
  Front-end
   BJAB0715_02845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AGQ07491
LinkDB All DBs
Position
complement(2945897..2946991)
Genome map
AA seq 364 aa AA seqDB search
MNMPVKVEYFKNPKNRDLTPAELEAFAKELDQIKQEVLDDLGEKDAKYIRRVYAAIRYSS
FLGRACLFAGWFPPAWILGTGLLGFSKIMENMELGHNVMHGQYDWMNDPKFNGQTYEWDT
VGTSDNWRQTHNYKHHTYTNIKGIDDDIGYGLLRLFPEQRWKPGFLLQPIYSIPFCLLFQ
WGVAIQNLEIGRVLYKRKTKAQFLEELKPVNKKIGKQLFKDYVFFPLIAGPAALPVFTGN
LVANGLRNIWTFSIIFCGHFTKDAEVFPKSVLQEESRGHWYMRQIRGSSNLTGSEAFHIL
SGHLSHQIEHHLFPDIPARRYRQMAPKVEAVCKKYGLNYNNASFVKQFGQVVGRIVKYAF
PFKK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgccagtgaaagtcgaatattttaaaaatcctaaaaatcgagatttgactcca
gcagaacttgaagcatttgcaaaagagcttgatcagatcaaacaagaagtattggatgat
ttgggcgaaaaagacgctaaatatatccgccgtgtctatgctgctattcgttatagtagc
tttttaggccgggcttgtttatttgcaggttggttcccgccagcgtggattttaggtacg
ggtttattaggtttctctaaaattatggagaacatggagctcggccataatgttatgcac
ggtcaatatgactggatgaatgacccgaaatttaatggtcaaacttatgaatgggatact
gtaggtacctctgacaactggcgtcaaacccacaactataaacatcatacttataccaat
attaaaggtattgatgatgacattggttatggcttacttcgcttattccctgaacaacgt
tggaagccagggttcttgttgcaacctatttacagtattccattttgcttattgttccag
tggggcgtagcaattcagaatcttgaaattgggcgtgtactttacaagcgtaaaactaag
gcacaatttttagaagagttaaaaccggttaataaaaagattggcaagcaactctttaaa
gattatgttttcttcccacttattgcagggccggcagcactaccagtatttacaggtaac
ttagttgcaaatggtcttcgtaatatctggacctttagtattattttctgtggtcatttc
acgaaagatgctgaagtgtttccaaaatctgttttacaagaagaaagtcgtggacactgg
tatatgcgccaaattcgtggttcttctaacttaacaggttcagaagcattccatattttg
tctggtcacttaagtcatcaaattgaacatcacttattcccagatattcctgctcgtcgt
tatcgccaaatggctccaaaagttgaggcggtttgtaagaaatatggcttgaactataac
aatgcaagctttgttaagcagtttggacaagtggttgggcgtattgtgaaatatgcgttc
ccatttaaaaaataa

DBGET integrated database retrieval system