KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_03085Help
Entry
BJAB0715_03085    CDS       T02727                                 

Definition
(GenBank) Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00020  Citrate cycle (TCA cycle)
abab00190  Oxidative phosphorylation
abab00650  Butanoate metabolism
abab01100  Metabolic pathways
abab01110  Biosynthesis of secondary metabolites
abab01120  Microbial metabolism in diverse environments
abab01130  Biosynthesis of antibiotics
abab01200  Carbon metabolism
Module
abab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abab_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJAB0715_03085
   00650 Butanoate metabolism
    BJAB0715_03085
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJAB0715_03085
Enzymes [BR:abab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJAB0715_03085
    1.3.5.4  fumarate reductase (quinol)
     BJAB0715_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGQ07731
LinkDB All DBs
Position
complement(3214629..3215339)
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALKVQDETLTFRRSCREG
ICGSDGVNINGKNGLACLQNLNDLPEKIVIRPLPGLPVVKDLVVDMNQFYDQYDKIQPFL
INNQPAPPKERLQSPEEREHLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFI
IDSRDTATAERLARLDDPFSLFRCKGIMNCVSVCPKGLNPTKAIGHIRNMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtactcgtacattcgaaatctaccgctatgatcctgataaggataaagcg
ccgtacatgcaaactttcaagcttgaattgactgataagcaccgtatgttgcttgatgca
ttgcttgctttgaaggttcaagacgaaacgttaacattccgtcgttcttgccgtgaaggt
atttgtggttctgatggtgtgaatatcaatggtaaaaatggtttggcttgcttgcaaaac
cttaacgatttaccagagaaaatcgtaattcgtccattacctggtttgccggttgttaaa
gatttggttgttgatatgaaccaattctatgatcagtatgacaaaattcagccattcttg
atcaataaccaacctgctccacctaaagagcgtttgcaatctcctgaagagcgtgaacac
ttaaatggtttgtatgagtgtattctttgtgcatgttgttcaacttcatgcccatcattc
tggtggaaccctgataaattcttgggtccttcagcgttgttgaatgcatatcgttttatt
atcgactctcgtgatactgcaactgcagaacgtttggctcgtcttgacgatccgttcagt
ttgttccgttgtaaaggtattatgaactgtgtgtcagtatgtcctaaaggtttgaatcca
acaaaagcaatcggtcatatccgtaatatgttgttagatcaagcgggttaa

DBGET integrated database retrieval system