KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_03086Help
Entry
BJAB0715_03086    CDS       T02727                                 

Definition
(GenBank) Succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00020  Citrate cycle (TCA cycle)
abab00190  Oxidative phosphorylation
abab00650  Butanoate metabolism
abab01100  Metabolic pathways
abab01110  Biosynthesis of secondary metabolites
abab01120  Microbial metabolism in diverse environments
abab01130  Biosynthesis of antibiotics
abab01200  Carbon metabolism
Module
abab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abab_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJAB0715_03086
   00650 Butanoate metabolism
    BJAB0715_03086
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJAB0715_03086
Enzymes [BR:abab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJAB0715_03086
    1.3.5.4  fumarate reductase (quinol)
     BJAB0715_03086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AGQ07732
LinkDB All DBs
Position
complement(3215354..3217189)
Genome map
AA seq 611 aa AA seqDB search
MGAINPKEDYSNIQNLTFDAVIVGGGGSGMRASYQLAQAGLKVAVLTKVFPTRSHTVAAQ
GGIGASLGNMQEDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHLGMPFDRNA
DGTIYQRPFGGHSANYGDKPVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLI
RNEAGDVLGVTAIDQETGNIAVFQAKATLFATGGAGRVYRASTNAYINTGDGLGMAARAG
IPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEPFMERYAPTLKDLAPRDFVS
RSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVFEIGKKFANVDITKEPIPVVP
TIHYQMGGIPTNMHGQVCLPEPGTDNYTKPVKGFYAIGECSCVSVHGANRLGTNSLLDLV
VFGKAAGEHIIDYVTKHHGDEYAPLPTNVLEQTLARVRKLDESTSGENAQEVADAIRDIV
QDHAGVFRTQALLDKGVKEILALEPRVRNIHLKDKSKVFNTARVEALEVENLYEVAKATL
ISAAARKECRGAHTVVDYELPADHPTYSYGRRDDEWMKHTLWYSSDNRLEYKPVRFKPLT
VDPIPPAPRTF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgataaaccctaaagaagattattcaaatattcaaaacctcactttcgatgct
gttatcgttggtggtggtggttctggtatgcgtgcatcttaccaacttgctcaagcaggt
ttgaaagttgcagtacttactaaagttttcccaacacgttcacatacagttgctgctcag
ggcggtattggtgcgtcgttaggtaacatgcaagaagataactggcatttccacttttac
gatacagtaaaaggttctgactggttaggtgaccaagacgcaatcgaatttatgtgtcgt
gaggcgccaaaagttgtttatgaacttgaacacttaggtatgccgttcgaccgtaacgct
gatggtacaatttaccaacgtccgttcggtggtcactctgcaaattatggtgataagcca
gttccacgtgcttgtgctgctgccgaccgtactggtcacgctttattgcacacgctttat
caaagcaacgtgaaaatgggtactcaattcttcgttgagtggatcgctcttgatttgatc
cgtaacgaagcgggtgatgtactcggtgtaactgcaattgaccaagaaactggtaacatt
gcagtattccaagcaaaagcaacattatttgcaactggtggtgctggtcgtgtttaccgt
gcatcaacaaatgcttatatcaacactggtgacggtcttggtatggctgctcgtgctggt
attccattacaagatatggaattctggcaattccaccctacaggtgttgcgggcgcaggc
gtattgttgactgaaggttgtcgtggtgaaggtgcgatccttcgtaacaaagacggcgaa
cctttcatggaacgttatgcaccaactttaaaagacttggctccgcgtgacttcgtatca
cgttctatggaccaagaaattaaagaaggtcgtggttgtggtccaaaaggtgattatatc
ttgcttgatatgactcacttgggtgctgacacaattatgaagcgtttaccatctgtattt
gagattggtaaaaaattcgcaaacgttgacatcactaaagaaccaattccagtagtacca
acaatccattatcaaatgggtggtattcctacgaatatgcatggtcaagtgtgcttacca
gagcctggtacagacaactacactaaacctgtaaaaggtttctatgcaatcggtgagtgt
tcatgtgtatcagtacatggtgcgaaccgtttaggtactaactcacttcttgacttggtt
gtatttggtaaggctgctggtgagcacattatcgattacgtaactaagcatcatggtgat
gaatatgcaccgcttccaacaaatgtattagagcaaactttagctcgtgtacgtaaattg
gatgaatcaacttctggcgaaaatgctcaagaagttgctgatgcaattcgtgatattgtt
caagaccacgcaggtgtattccgtactcaagcattgcttgataaaggtgttaaagagatt
cttgctcttgaaccacgcgtgcgtaacattcacttgaaagataaatctaaagtatttaac
actgcacgtgttgaagcgcttgaagttgaaaacttatatgaagttgcaaaagctacatta
atttcagctgctgcgcgtaaagaatgtcgtggtgcgcatacggtagttgattatgaatta
ccagctgatcacccaacttattcatacggtcgccgtgatgatgagtggatgaaacacact
ttatggtattcatcagataaccgtttggaatataagccagtgcgcttcaagccgttaact
gttgatccaattccaccagcaccacgtacattctaa

DBGET integrated database retrieval system