KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_03186Help
Entry
BJAB0715_03186    CDS       T02727                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112-like protein)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
abab00970  Aminoacyl-tRNA biosynthesis
abab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJAB0715_03186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abab03029]
    BJAB0715_03186
Enzymes [BR:abab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BJAB0715_03186
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BJAB0715_03186
Mitochondrial biogenesis [BR:abab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BJAB0715_03186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGQ07832
LinkDB All DBs
Position
3314261..3315730
Genome map
AA seq 489 aa AA seqDB search
MAEAQKLKLIDGWEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPV
LNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQLE
DGTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYI
KAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEI
ERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAI
KATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVM
GEFSGALNKAGLELTDSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGKSADDII
AEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQV
NELMKKLIG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaaaagttgaaattgattgacggttgggaagtcgttattggtattgag
attcatactcagcttgcaaccaattctaaaattttctcaggttcatcaactgaatttggt
caagacccaaatacacaagcgagccttgtagacttggcgatgccgggtgtattgccggtt
ttaaatgaaaaagtggttgaactcgcaattcgttttggtttagggattgatgcttacatc
gaccaagcttcagtatttgcacgtaaaaactacttctatcctgactctccaaaaggctat
caaattagccaaatggataacccgattgtgggcttgggccatatcgatattcaacttgaa
gatggtacgactaaacgcattggcgtaactcgtgctcaccttgaagaagatgcaggtaag
tctgtgcacgatcaatttgaaggtatgtctggcattgacttaaaccgtgctggtacgcct
ttgcttgaaatcgtttctgaaccagacatgcgttcggttgaagaagcagttgcctacatc
aaagcaattcacacactagtacgttggttaggtatttctgacggtaacatggctgaaggt
tcattccgtgcggactgtaacgtgtctttacgtcgtccgggacagccattcggtacacgc
tgtgaacttaaaaacctcaactcattccgtttcattgagcaagcgatcaatgtggaaatt
gaacgccaaatggaaattttggaatggggcggcgaaattgaccaagaaactcgtttgttc
gatccaaataaaatggaaacgcgttctatgcgttctaaagaagaagcgaatgactaccgc
tacttccctgatccagacttgttaccagtaattattccagatgagcaaattgaggccatc
aaggcaactatgcctgagttgccagcagcacgccgtgcacgctttattgcagactttggc
gtaactgaatacgacgcacacgtacttacgctctcacgcgaaatggcggacttctatgaa
gctgttgttgctgcggctggtggtgcgaagcaaggtaaaattgctgcaaactgggtaatg
ggtgaattctctggtgctttaaacaaagcgggcttagagttaacagactcacctgtttct
gctgaacagcttggcggcatgattgcgcgtattatcgacaacaccattagcggtaaaatt
gctaaacaagtctttggctttatgtgggaatcggaaggtaaatctgccgatgacattatt
gcggaaaaaggcttaaagcaagaaaccgatactggcgcaattgaagcaatcattaaagaa
gtacttgcagccaatgaaaaaatggttgaagagtacaagtctggtaaagaaaaagccttt
aacggtcttgttggtcaagtcatgaaagcttctaagggtaaagccaaccctgctcaagtg
aatgaattaatgaaaaagttaattggttaa

DBGET integrated database retrieval system