KEGG   Luteitalea pratensis: LuPra_00403Help
Entry
LuPra_00403       CDS       T04394                                 

Gene name
ykoU_1
Definition
(GenBank) putative ATP-dependent DNA ligase YkoU
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
abac  Luteitalea pratensis
Pathway
abac03030  DNA replication
abac03410  Base excision repair
abac03420  Nucleotide excision repair
abac03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:abac00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LuPra_00403 (ykoU_1)
   03410 Base excision repair
    LuPra_00403 (ykoU_1)
   03420 Nucleotide excision repair
    LuPra_00403 (ykoU_1)
   03430 Mismatch repair
    LuPra_00403 (ykoU_1)
Enzymes [BR:abac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LuPra_00403 (ykoU_1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     LuPra_00403 (ykoU_1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LuPra_00403 (ykoU_1)
DNA replication proteins [BR:abac03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    LuPra_00403 (ykoU_1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     LuPra_00403 (ykoU_1)
DNA repair and recombination proteins [BR:abac03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LuPra_00403 (ykoU_1)
   NER (nucleotide excision repair)
    Other NER factors
     LuPra_00403 (ykoU_1)
   MMR (mismatch exicision repair)
    Other MMR factors
     LuPra_00403 (ykoU_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AMY07236
UniProt: A0A143PFN9
LinkDB All DBs
Position
complement(470272..471867)
Genome map
AA seq 531 aa AA seqDB search
MQRFSALYATLDRTLSTNAKVAALEAYFREAPPQDAAWTVFFLAGRRLLRLLPTKLLREW
TQDTTGIAPWLLHESYAAVGDFAETLALLLDGVPAEGDERTVPLHVWIEERLEGLRAKPP
DAQREDVVRWWRALPSFERYLLNKLLTGEMRVGVSQTLVVRALAAVAGVGTDVMTLRLMG
QWSPSAQAFAALMAPDGLADETSRPYPFCLAYPLEQGVESLGPRADWQAEWKWDGIRAQL
IRRAGHTYLWSRGEEVITARFPEVVSAAAALPDGTVLDGEVLAWDGDGPLPFARLQLRIG
RQNLTRQALASAPAAFMAYDLLEDDGRDVRAMPLAERRLRLEALIARHAPGLRLSPIVTE
PDWEALGTLRQESRTRGVEGYMLKRLDSAYGTGRRKGDWWKWKVDPFSVDAVLVYAQPGN
GRRATLFTDYTFALWKDGELVPVAKAYSGLSNEEIEQVDRWVRANTLEKFGPVRRVTPAL
VFEVAFENVQRSTRHKSGVAVRFPRIARWRKDKGAQDADHIQALIDLIRAT
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgcttctccgcactctacgccacactcgaccgcacgttgtccaccaacgccaag
gtggcggctctcgaggcctacttcagggaggcgccaccgcaggacgccgcgtggacggtc
ttcttcctggcgggccggcgcctgttgcggctgttgccgacgaagctgctgcgcgagtgg
acgcaggacacgacgggcatcgcgccatggctgctccacgagtcgtacgcggcggtcggg
gatttcgccgagacgctggcgctgctcctcgatggcgtgcccgcggagggtgacgagcgc
accgtcccgctgcacgtctggatcgaggagcggctcgagggcctgcgtgcgaagccgccc
gacgcgcaacgcgaggatgtcgtgcgctggtggcgcgccttgccgtcgttcgagcggtac
ctgctcaacaagctgctgaccggtgagatgcgggtcggagtctcgcagacgctggtggtt
cgggcgctggcggcagtcgcaggcgtcggaaccgacgtcatgaccctccggctgatgggc
cagtggagcccatcggcgcaggcgttcgctgcgctgatggcgccagatggattggccgac
gagacgtcgcggccttacccgttctgcctggcgtacccgctggagcagggcgtggagtcg
ctcgggcctcgtgcggactggcaggcagagtggaaatgggacggcattcgcgcgcagctg
atcagacgcgccggccacacctacctctggtcgcgcggtgaagaagtgatcacggcacgg
ttccccgaggtcgtctcggcagcggcggcgcttcccgatggcacagtgctcgacggcgag
gtgctcgcgtgggacggcgatgggcccctgcccttcgcgcggctgcagctccgcatcggc
cgccagaatctcacccggcaggccctggccagtgcccctgccgcattcatggcgtacgac
ctgctcgaggacgacggccgcgacgtgcgtgcgatgcccttggcggaacggcggctccgc
ctcgaggcactcatcgcgcggcatgctccgggcctgcggctgtcgcccatcgtcacggaa
cccgactgggaggcactcggcacgctgcggcaggagtcacggacgcgaggcgtcgaaggc
tacatgctcaagcgactcgactcggcatacggcaccggacgccgcaagggcgactggtgg
aaatggaaggtcgaccccttctcggtcgatgcagtgctggtgtacgcgcagccgggtaac
ggccggcgggcgacgctgttcaccgactacacgttcgcgctgtggaaggacggtgaactg
gtcccggtggcgaaggcctactcgggactctcgaacgaggaaatcgaacaggtggatcgc
tgggtgcgggcgaacacgctcgagaagttcgggccggtgcgtcgcgtcactccggcgctg
gtgttcgaggtcgcgttcgagaacgtccagcgatcgacccgccacaagagcggcgtcgcc
gtccgcttcccccgcatcgcgcgctggcgcaaggacaagggggcacaggacgccgaccac
atccaggccttgatcgatctcataagggccacgtaa

DBGET integrated database retrieval system