KEGG   Luteitalea pratensis: LuPra_01085Help
Entry
LuPra_01085       CDS       T04394                                 

Definition
(GenBank) Putative DNA ligase-like protein
Organism
abac  Luteitalea pratensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AMY07902
UniProt: A0A143PH44
LinkDB All DBs
Position
complement(1287643..1288734)
Genome map
AA seq 363 aa AA seqDB search
MARGDVTPPVEPMLAKAATDLPDGDGWCYEPKWDGFRAIAFRDGGSVYIQSRDLKPLDRY
FPDVHDALVRGLPDGAVVDGEVVIATPRGLDFDALQMRLHPAASRVEKLSRETPASFVAF
DVLAADHEDLRRHPLAARRARLEALAPGFTPSMHLTPLTRDRALAADWLARFEGAGLDGV
VAKHADAIYEPGRRTMVKIKHVRTADCVVAGFRWHKAGPETHVGSLLLGLYDDAGVLQHV
GVTSSFTMAMRQQLATELAPLRKDALREHPWRAWAEVSAAGTRMPGGQSRWSAGKDLSWE
PLRIERVCEVTYDHLQGNRFRHATVFRRWRPDKPQEHCRYDQLEVTTPYELARVFSAARA
GSA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaggtgacgtgacaccgccggtcgagccgatgctggccaaggccgcgacagac
ctgcccgacggtgacggctggtgctacgagccgaagtgggatggcttccgggcgatcgcg
tttcgtgacggcggctccgtctacatccagagccgggacctgaagccgctcgatcgctac
ttccccgacgtccacgacgcgctcgtccggggcttgcctgacggggcggtcgtcgacggc
gaggtggtcatcgccacgccgcgtggcctcgacttcgatgcgctgcagatgcggctgcac
ccggccgcgtcgcgcgtcgagaaattgtcgcgcgaaacgccggcttccttcgtcgcgttc
gacgtgctcgccgccgatcacgaggacctgcgcaggcacccgctggcggcccggcgcgcg
cgcctcgaagcgctcgcgcccggcttcacgccgtcgatgcacctcacgccactgacacgc
gaccgtgccctcgcggcggactggctggcccggttcgaaggagcggggctcgatggcgtt
gtcgccaagcacgccgatgcgatctacgagcctggccgccgcacgatggtcaagatcaag
cacgtccgcactgccgattgcgtcgtcgccggcttccgctggcacaaggccggcccggag
acacatgtgggttccctgctgctcggcctgtacgacgatgccggcgtcctgcaacacgtg
ggcgtgacgtcgtcgttcacgatggcgatgcgtcagcagctagcgaccgaactcgcgccg
ttgcggaaggacgccttgcgcgagcacccgtggcgcgcatgggccgaagtcagcgccgca
ggcacgcgaatgcccggcgggcagagtcgctggagcgcgggcaaggatctgtcgtgggaa
cccctgcgcatcgagcgggtatgcgaggtgacctacgaccacctgcagggcaatcggttc
cgccacgcgacggtgttcaggcgctggcgccccgacaagccccaggagcactgccgctac
gaccagctcgaggtcacgactccttacgagttggcgcgtgtcttctccgcggcgcgggcg
gggtctgcgtaa

DBGET integrated database retrieval system