KEGG   Luteitalea pratensis: LuPra_01138Help
Entry
LuPra_01138       CDS       T04394                                 

Gene name
glpD_2
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
abac  Luteitalea pratensis
Pathway
abac00564  Glycerophospholipid metabolism
abac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LuPra_01138 (glpD_2)
Enzymes [BR:abac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LuPra_01138 (glpD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 NAD_binding_8 HI0933_like Pyr_redox_3 GIDA 3HCDH_N Pyr_redox Trp_halogenase CaATP_NAI
Motif
Other DBs
NCBI-ProteinID: AMY07953
UniProt: A0A143PI66
LinkDB All DBs
Position
complement(1349197..1350756)
Genome map
AA seq 519 aa AA seqDB search
MRRSDMLARLDQHKDPWDLVVIGGGATGVGIAVDAASRGYDVLLLEQHDFGKGTSSRSTK
LVHGGVRYLEQGNIALVMEALKERGLLRQNAPHLVSNLAFVVPNYDWWEAPFYGLGLKVY
NALAGKYGFGPSEILTREQTLARLPTIKTEGLRGGVVYYDGQFDDARLLINLVTTAAEQG
ATLVNYARVVDITKEPDGFIGGVVAVDEESGRQWTVAARVVINATGAFSDTVRRLAEPDV
AALIAPSQGIHLVFHESFLSADAAIMVPHTTDGRVMFAIPWHGHTLVGTTDTPIDTPTLE
PLPLQEEIDFILETAGRYLHKAPTREDVLSVFVGIRPLVKGGDGRLTAALSRDHTIHIDS
SGLLTTTGGKWTTYRNMAEHTVDQAADLARLTERPCVTRTLNVHGFHTNADRFGALSIYG
SDALAIQELVRETPSLGTPLHADLPYTGAEVVWATRHEMARTVEDVLARRTRALFLNARA
AVAMAPDVARLMAGELGWDAAWQAAEVAAFAGLAKGYQI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgctccgacatgctggcgaggctcgaccagcacaaagatccctgggatctcgtc
gtcatcggcggcggtgccaccggtgtcggcatcgccgtggacgcggcgagccgcggctat
gacgtcctgctcctcgagcagcacgacttcggcaagggcacgtcgagccggagcaccaag
ctggtacacggcggcgtccgttacctggaacagggcaacatcgcgctggtgatggaagcg
ctcaaggagcgcggcctgcttcgccagaatgcgccgcacctcgtgagcaaccttgccttc
gtcgtcccgaactacgactggtgggaagcgccgttctacggcctgggcctcaaggtctac
aacgcgctggctggcaagtacggcttcgggccatccgagatcctcacccgcgagcagacg
cttgcacgcctgccgacgatcaagaccgagggcctgcgcggcggcgtcgtctattacgac
ggccagttcgacgacgcacggctgttgatcaacctggtgacaacggcggccgagcagggc
gcgacgctggtcaactacgcgcgggtggtcgacatcacgaaggagcccgacggcttcatc
ggcggcgtcgtggccgtcgatgaggagagcggccggcagtggaccgtcgcagcacgcgtg
gtcatcaacgcgacgggcgcgttctcggacacggtgcggcggctcgccgaacccgacgtc
gcagccctgatcgcgccgagccagggcattcacctggtgttccacgagtcgttcctgtcg
gccgacgccgcgatcatggtgccgcacacgaccgacggtcgggtgatgttcgcgattccg
tggcacggacacacacttgtcggcaccaccgacacgccgatcgacacgccgacgctcgag
ccgttaccgctgcaggaggagatcgacttcatcctcgagaccgccggccggtacctccac
aaggcaccgacgcgagaggatgtcctcagcgtgttcgtcggcatccgtccgctcgtcaag
ggtggcgacggcagattgacggccgcgctgtcgcgcgatcacaccatccacatcgactcg
tcggggctcctgacgacgaccggcggcaagtggacgacgtaccggaacatggcggagcac
accgtggatcaggccgccgaccttgcgcgcctgaccgagcggccctgcgtcacgcgtacg
ctcaacgtgcacgggttccacacgaatgccgatcgcttcggcgcgttgagcatctacggt
tccgacgcgctcgcgatccaggaactggttcgcgagacgccgtcgcttggcacgccgctg
catgccgacctgccgtacaccggcgcggaggtcgtctgggccacccgtcacgagatggcg
cgcaccgtcgaggacgtgctcgcgcgccgcacgcgcgccctgttcctcaacgcacgcgcg
gccgtcgccatggcgcccgacgtggcgcggctcatggccggcgaacttggctgggatgcc
gcgtggcaggcggcggaagtggccgcattcgcggggctcgccaaggggtatcagatctag

DBGET integrated database retrieval system