KEGG   Luteitalea pratensis: LuPra_02363Help
Entry
LuPra_02363       CDS       T04394                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
abac  Luteitalea pratensis
Pathway
abac03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:abac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    LuPra_02363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:abac03400]
    LuPra_02363
Enzymes [BR:abac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LuPra_02363
DNA repair and recombination proteins [BR:abac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LuPra_02363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_C DNA_ligase_A_M mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AMY09150
UniProt: A0A143PLT9
LinkDB All DBs
Position
complement(2874259..2875113)
Genome map
AA seq 284 aa AA seqDB search
MPEWLEPMAATLTQERFGAGGDWVFERKFDGIRLLAYKRGSDIRLYSRNRLPQNLPGVAR
AIASLPLEDVILDGEVTWDGHSGYHVFDILWMDGQRLTMLPLEERRALLEALPFEEPMRR
VELLDDADPWDRARRERWEGVIAKRRGSPYEHRRSRHWLKLKCEFSQEFVVGGFTDPQGA
RVGLGALLVGYHDGADLVFAGKIGTGFDTKLLLDLRHRLDAIGLENSPFTRAVGLPRVRV
HWVSPQIVVQVAFIEWTPNDKLRHPRLIGVRFDKDPRDVVRDHA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagtggctcgagccgatggccgccacgctcacgcaggagcgcttcggcgcgggc
ggcgactgggtgttcgagcgcaagttcgacggcatccggctccttgcctacaagcgcggc
agtgatatccgtctgtactcgcgcaatcgcctcccccagaacctgcccggcgtggcccgg
gccatcgccagccttcctctggaggacgtgatcctcgacggcgaggtaacgtgggacggc
cacagcggctaccacgtcttcgacatcctgtggatggacggccaacgcctgacgatgctg
ccgttggaggagcggcgcgccctgctggaggcgctgccattcgaggagccgatgcgacgc
gtcgaactgctcgacgacgccgatccgtgggaccgcgcacggcgggagcgatgggagggc
gtgatcgccaaacggcgaggctcaccgtacgagcaccgccgctccaggcactggctgaag
ttgaagtgcgagttctcgcaggagttcgtggtcggaggcttcaccgatccacagggcgcg
cgggtcggcctcggcgcgctgctcgtcggctaccacgatggggccgacctcgtgtttgcc
ggcaagatcggcacgggcttcgacacgaaattgctactcgatcttcgccaccgcctcgac
gccattggtctcgagaacagcccgttcactcgggcggtcggcctgccgcgtgtgcgcgtg
cactgggtcagcccgcagatcgtggtgcaggtggcgttcatcgagtggacgcccaacgac
aagctgcgtcacccgaggctgatcggcgtccgcttcgacaaggaccctcgagacgtggtc
agggatcacgcgtga

DBGET integrated database retrieval system