KEGG   Luteitalea pratensis: LuPra_03105Help
Entry
LuPra_03105       CDS       T04394                                 

Definition
(GenBank) D-arabitol-phosphate dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
abac  Luteitalea pratensis
Pathway
abac00040  Pentose and glucuronate interconversions
abac00051  Fructose and mannose metabolism
abac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LuPra_03105
   00051 Fructose and mannose metabolism
    LuPra_03105
Enzymes [BR:abac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LuPra_03105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH PALP
Motif
Other DBs
NCBI-ProteinID: AMY09878
UniProt: A0A143PP30
LinkDB All DBs
Position
3788844..3789914
Genome map
AA seq 356 aa AA seqDB search
MGAMQPAVVQFGLDQPLQVALRDVPVPEIGPADVLLAVGAASVCGSDVHQAYLTHSWPVN
APVTLGHEFGGVVAQVGADVKAFKEGDRVVSETAAYICGECLLCRTGRYNLCPTRKGFGY
GIDGAMAQYVRVPARCLHHIPDTLPFDIACLTEPHCVAYQSMCVNADIKPGDLVVVLGPG
PIGLLCAKMAALSGAYPLVVAGRAADRGRLEVARELGATHVVDVDNQSLEEVVRALDPLG
ADVVCDASGASRPLDAALQMCKPDGTVVKVGWSPDLVPINLNPLVQKAVRLHGSFSHNYP
VWERVISLLAAGRTGAEKVVGLRTDLEHWHEAFEGMHSGQVIKSVLLPHGPEGPKR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccatgcaacccgccgtcgtgcagttcggcctcgaccagccgttgcaggtggcc
ctgcgcgacgtcccggtgcccgagatcgggccggccgacgtgctgctggccgtgggcgcc
gcctccgtctgcggctcggacgtgcaccaggcctacctgacgcattcatggccggtcaac
gcgccggtgacgctcgggcacgaattcggtggcgtcgtcgcccaggtcggtgccgacgtg
aaggccttcaaggaaggcgaccgcgtcgtcagtgagaccgccgcgtacatctgcggcgag
tgcctgctgtgccgcaccggtcgctacaacctgtgtccgacccgcaagggattcggctac
ggcatcgatggcgcgatggcgcagtacgtgcgcgtgccggcgcgctgcctgcatcacatt
cccgacacgctgccgttcgacatcgcgtgcctgaccgagccgcactgtgtcgcctaccag
tcgatgtgcgtcaatgcggacatcaagccgggtgatctcgtggtcgtgctcggtcctgga
ccgatcggattgctctgcgcgaagatggccgcgctcagtggcgcgtacccgctcgtggtc
gctggccgcgcggccgaccggggacgcctcgaggtcgcgcgcgaactcggcgcgacgcat
gtcgtcgacgtcgacaaccagtcactcgaggaggtcgtgcgcgcgctcgacccgctgggc
gccgatgtcgtgtgcgatgcctcgggggcgagccgtccgctcgatgcggcgctgcagatg
tgcaagccggacggcacggtcgtcaaggtcggctggtcgcccgatctggtgccgatcaat
ctcaatccgctcgtccagaaggccgtgcggttgcatggctccttcagccacaactacccg
gtgtgggagcgcgtgatcagcctgctggccgccggccggaccggcgccgagaaggtggtg
ggcctgcggacggatctcgaacactggcacgaggccttcgaaggcatgcacagcggccag
gtgatcaagtccgtcctcctgccgcacggcccggaagggccgaagcgctag

DBGET integrated database retrieval system