KEGG   Luteitalea pratensis: LuPra_04398Help
Entry
LuPra_04398       CDS       T04394                                 

Gene name
prkC_36
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
abac  Luteitalea pratensis
Brite
KEGG Orthology (KO) [BR:abac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abac01001]
    LuPra_04398 (prkC_36)
Enzymes [BR:abac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LuPra_04398 (prkC_36)
Protein kinases [BR:abac01001]
 Serine/threonine kinases: Other
  Bacterial family
   LuPra_04398 (prkC_36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase zf-ribbon_3 RIO1 zinc_ribbon_15 Seadorna_VP7 zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AMY11151
UniProt: A0A143PRX6
LinkDB All DBs
Position
5228550..5229545
Genome map
AA seq 331 aa AA seqDB search
MLFKGQTLGKYRILSPLGSGGFGTVYLARDTWLDKQVAIKVPHRQGLDFSELLREPRLLA
SVNHPNIVAITTADKQDDIFFIVMEYVAGETLESVLEREGALDLPRALDYTVQIGNAVDH
AHKQGVIHRDLRPANVLVSENGMLKVADFGTSRFLEIAAHGTTVIGSPAFMAPEQFQGKA
VFASDLYSVGITMYQMLTGELPYEPPPPSALHKLLTGELVTPPRSRNPAIPRRLNDIVMK
ALAPQITDRYTRASDLLDDLLAAKSVILGTPGPRAIADLGLDDASRAARSNAPPLPRAVK
YQDREAARNCWHCRRPLHNLATKCPFCGENQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcaagggccagaccctcggcaagtatcgcatcctgtctccactgggaagcggc
gggtttggcaccgtctacctggcgcgcgacacgtggctggacaagcaggtggcgatcaag
gtcccccatcgccaaggtctcgacttctccgaactgctccgcgaaccgcgcctgctcgcc
agcgtcaaccacccgaacatcgtcgccatcaccacggccgacaagcaggacgacatcttc
ttcatcgtcatggagtacgtggccggcgagacgctggagagcgtcctcgagcgcgaaggc
gcgctcgacctgccgcgcgcgctggactacacggtgcagatcggcaacgccgtggaccat
gcgcacaaacagggcgtgatccatcgggatctgcggccggccaacgtgctcgtgtcggag
aacgggatgctcaaggtggccgacttcggcacgtcgcgcttcctggagatcgcggcccac
ggcacaacggtgattggcagcccggcattcatggcgcccgagcagttccagggcaaggcc
gtgttcgcgtcggatctctactcggtggggatcacgatgtaccagatgctcacgggcgaa
cttccctacgaaccaccgccgccgtcggcgttgcacaagttgctcacgggcgaactggtg
acgccaccccggtcacgcaatccggcgattccgcgccggttgaacgacatcgtcatgaag
gcgctggcgccacagattaccgaccgctacacccgcgcgtcggacctgctcgacgatctg
ctcgcggccaagtcggtcatcctcggcacgcccggacctcgcgccatcgccgatctcggc
ctggacgacgccagccgcgccgcccgctcgaacgccccgcccctgccccgcgcggtcaag
taccaggaccgcgaggccgcccgcaactgctggcattgccgtcgtcccctgcacaacctc
gcgaccaagtgcccattttgtggtgagaaccagtaa

DBGET integrated database retrieval system