KEGG   Luteitalea pratensis: LuPra_04692Help
Entry
LuPra_04692       CDS       T04394                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abac  Luteitalea pratensis
Pathway
abac00010  Glycolysis / Gluconeogenesis
abac00020  Citrate cycle (TCA cycle)
abac00620  Pyruvate metabolism
abac01100  Metabolic pathways
abac01110  Biosynthesis of secondary metabolites
abac01120  Microbial metabolism in diverse environments
abac01130  Biosynthesis of antibiotics
abac01200  Carbon metabolism
Module
abac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LuPra_04692 (aceF)
   00020 Citrate cycle (TCA cycle)
    LuPra_04692 (aceF)
   00620 Pyruvate metabolism
    LuPra_04692 (aceF)
Enzymes [BR:abac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LuPra_04692 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N QRPTase_N NQRA
Motif
Other DBs
NCBI-ProteinID: AMY11442
UniProt: A0A143PS73
LinkDB All DBs
Position
complement(5574847..5576565)
Genome map
AA seq 572 aa AA seqDB search
MANEMTLPSLGENIKAGDVLRVLIKAGDAVTVDQPVLELETDKATVEVPSTLAGTVAEVR
VKDGDRIDVGQVVFTVSGDAATAPAKPASGAPAVGQAAAAVDAQDAAPAGGKAAPPSPRT
AAAPSSGGGRIEVTIPSLGENVKGGDVLHVLVKVGDTVAVEQGILELETDKATVEVPSPS
AGVVKEVAVKDGDQVAVGQLVLVLEGTGIGEPAPPSTAGPATPGAAAAAQAATPERQAEK
GQPMAPAARAAAPVAPKGAGTGAVAPPRPNVPAAPSVRRLARELGLDIADVPGSGKSGRI
SETDVRAHAKNVITGKVAGPAGAAPTGGGFAYEPLPDFSVYGAVERKAMRGIRRKTAEHM
VASWHTIPHVTQCEKVDITALEQLRKQFGKRVEAGGGKLTVTSIITKVIAVGMRKFPQFN
TSVDLAAEEVIYKSYVNIGIAVDTERGLLVPVLRDVDTKSITQISAELAQLAEKARSGKL
SMDEMSGGCFTITNLGGIGGTHFTPIVNHPEVAIMGMSRSAMEPVWNGTSFEPRLMMPLS
LSYDHRIIDGADAMRFLRFVAEALEQPFLLAL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaaatgacgctgccctcgctgggcgagaacatcaaggcgggggatgtgctc
cgggtgctgatcaaggccggcgatgccgtgaccgtcgatcagcccgtgctggaattggag
accgacaaggcaacggtggaggtgccctcgacgttggcgggcaccgtcgccgaggtccgc
gtcaaggacggcgatcggattgacgtcggccaggtagtgttcacggtcagcggcgacgcc
gcaaccgcaccggccaagccggcgtctggcgcgccggccgtcggccaggcggccgccgcc
gtcgacgcgcaggacgcagcgcccgcaggtggcaaggccgccccgccatcgcctcgaacg
gccgctgctccgtcatcgggcggcgggcgcatcgaggtgacaatcccgtcgctcggcgag
aacgtgaagggcggcgacgtcctgcacgtgctcgtgaaggtgggcgacacggtggcggtg
gagcagggcatcctcgagctcgagaccgacaaggccactgtcgaagtgccgtcgccgagc
gcgggtgtcgtgaaggaagtcgcggtcaaggacggcgaccaggtggccgtcggccaactg
gtactggtgctcgaagggaccgggatcggcgaaccggccccaccgtcgaccgcggggccg
gccacgccgggagcggccgccgccgcgcaggccgcgacgcctgaacgccaggccgagaag
ggacagccgatggcgccggcggctcgtgccgcggcacccgtggcgccgaagggcgctggc
accggggccgtggcgcctccgcgtccgaacgtcccggccgcgccgtcggtccgtcgtctt
gcccgcgagctcggcctcgacatcgcggacgtgcccggatcgggcaagagcggccggatc
agcgagacggacgtgcgtgcgcacgccaagaacgtcatcaccggcaaggtggccggcccg
gccggcgccgcgcccacgggcggcgggttcgcctacgaaccgctgccggacttttccgtc
tacggcgccgtcgagcgcaaggcgatgcgcggcatccgccgcaagaccgccgagcacatg
gtggccagctggcacacgattccgcacgtcacgcagtgcgagaaggtggacatcacggcg
ctcgagcaactgcgcaagcagttcggcaagcgcgtcgaggccggcggcggcaagctcacc
gtgacgtcgatcatcaccaaggtgatcgcggtggggatgcgcaagttcccgcagttcaac
acctcggtcgacctcgcggccgaagaggtgatctacaagtcgtacgtcaacatcggcatt
gccgtcgacaccgagcgcgggctgctcgtgccggtgctgcgcgacgtcgacaccaaatcg
atcacgcagatctcggccgagctcgcgcagctggccgagaaggcgcgcagcggcaagctg
tcgatggacgagatgtcgggcggctgcttcacgatcaccaacctcggcgggatcggcggc
acgcacttcacgccgattgtcaaccacccggaggtggcgatcatgggtatgtcgcggtcc
gcgatggagccggtgtggaacgggacgagtttcgagccgcggctgatgatgccgctctcg
ctctcctacgaccaccggatcatcgacggcgccgacgccatgcgcttcctgcggttcgtc
gccgaggcgctcgaacagccgttcctgcttgcactttag

DBGET integrated database retrieval system