KEGG   Luteitalea pratensis: LuPra_05846Help
Entry
LuPra_05846       CDS       T04394                                 

Gene name
ddl_2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abac  Luteitalea pratensis
Pathway
abac00473  D-Alanine metabolism
abac00550  Peptidoglycan biosynthesis
abac01100  Metabolic pathways
abac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LuPra_05846 (ddl_2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LuPra_05846 (ddl_2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LuPra_05846 (ddl_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abac01011]
    LuPra_05846 (ddl_2)
Enzymes [BR:abac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LuPra_05846 (ddl_2)
Peptidoglycan biosynthesis and degradation proteins [BR:abac01011]
 Precursor biosynthesis
  Amino acid ligase
   LuPra_05846 (ddl_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: AMY12569
UniProt: A0A143PXP9
LinkDB All DBs
Position
6913383..6914525
Genome map
AA seq 380 aa AA seqDB search
MGVIYGGRSGEHEVSIASAAAVMANLDRARYEPVPIRIDRDGRWSLADKPPTAASASEVI
EQTRAELKALRAGREVHLLPRPSEETILAIDRSHARGDDESRAIVTGVGLDVIVPVLHGP
HGEDGTVQGLLELANVPYVGCGVLASAVGMDKALMKRVFGAHGLPQCAYAVVLRRRVLAE
PDVVAGELEARLGLPMFVKPANLGSSVGISKARTREELVEALKLAADYDRKVVIEAAVPN
AREIEVAVLGNDDPIASVPGEVVPAREFYDYEAKYLDGASRLAIPADVPDEMGERLQALA
VDAFRAIDGAGLSRVDFLIDGQRGDVFVNEINTMPGFTTISMYSKLWAATGITYPELVDR
LVQLALERHAEKQRLRVSAF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtcatctacggtggccgctcgggcgagcacgaagtctcgatcgcctcggctgcc
gcagtcatggccaacctcgatcgcgcccgctacgagccggtgccgatccgcatcgatcgc
gatgggcgctggtcgctggccgacaagccgccaaccgcggcctcggcctcagaggtgatc
gagcagacgcgcgcggagttgaaggcgctgcgggccggacgcgaggtccacctgctgccc
cgtccgagcgaagagaccatcctcgccatcgatcgatcgcatgcgcggggtgacgacgag
tcgcgcgccatcgtgaccggggtcggcctggacgtcatcgtgccggtgttgcatgggcca
cacggtgaggacggcacggtgcagggcctgctcgaactcgccaacgtgccgtacgtcggc
tgtggcgtgctcgcctccgccgtcggcatggacaaggcgctgatgaagcgcgtcttcggc
gcgcacggcttgccgcagtgtgcctacgcggtcgtgctgcggcggcgtgtgctggcggag
ccggacgtcgtcgccggcgagctcgaggcccggctcggcctgccgatgttcgtcaagccc
gccaatctcggctcgagcgtcggcatctccaaagcgcgcacgcgcgaggagttggtcgag
gccctcaaactcgcggccgactacgatcgcaaggtcgtgatcgaggccgccgtgccgaac
gcgagggagatcgaggtcgccgtgctcggcaacgacgatccgatcgcgtcggtcccgggc
gaggtcgtgcccgcgcgcgagttctacgactacgaagccaagtatctcgacggcgcgagc
cgtctcgcgattccggccgacgtgcccgacgagatgggcgagcgcctgcaggcgctcgcc
gtcgacgccttccgcgcgatcgatggcgccgggttgagccgcgtcgacttcctgatcgac
gggcagcgcggcgacgtgttcgtcaacgagatcaacacgatgccgggcttcaccacgatc
agcatgtacagcaagctgtgggcggcgaccggcatcacctaccccgaactcgtcgatcga
ctcgtgcagctcgcgctcgagcggcacgccgagaagcagcggctgcgcgtctcggctttc
tga

DBGET integrated database retrieval system