KEGG   Acinetobacter baumannii D1279779: ABD1_02830Help
Entry
ABD1_02830        CDS       T02491                                 

Gene name
fadB
Definition
(GenBank) enoyl-CoA hydratase/delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase/3-hydroxyacyl-CoA dehydrogenase/3-hydroxybutyryl-CoA epimerase complex
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00071  Fatty acid degradation
abad00280  Valine, leucine and isoleucine degradation
abad00281  Geraniol degradation
abad00310  Lysine degradation
abad00362  Benzoate degradation
abad00380  Tryptophan metabolism
abad00410  beta-Alanine metabolism
abad00640  Propanoate metabolism
abad00650  Butanoate metabolism
abad00903  Limonene and pinene degradation
abad00930  Caprolactam degradation
abad01100  Metabolic pathways
abad01110  Biosynthesis of secondary metabolites
abad01120  Microbial metabolism in diverse environments
abad01130  Biosynthesis of antibiotics
abad01200  Carbon metabolism
abad01212  Fatty acid metabolism
Module
abad_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ABD1_02830 (fadB)
   00650 Butanoate metabolism
    ABD1_02830 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABD1_02830 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABD1_02830 (fadB)
   00310 Lysine degradation
    ABD1_02830 (fadB)
   00380 Tryptophan metabolism
    ABD1_02830 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABD1_02830 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABD1_02830 (fadB)
   00281 Geraniol degradation
    ABD1_02830 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABD1_02830 (fadB)
   00930 Caprolactam degradation
    ABD1_02830 (fadB)
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABD1_02830 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABD1_02830 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABD1_02830 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ABD1_02830 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AGH34174
LinkDB All DBs
Position
complement(322963..325116)
Genome map
AA seq 717 aa AA seqDB search
MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
VKKASKQHEKGAHPVNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEANN
LLTKQVERKKMKPAQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKNV
RENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATTV
VLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSKFGWPMGPAY
LIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKKGK
KAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADMAM
IMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgctggcaatgccattaccgtccaaatgcttgcggacggaattgcagaattc
cgctttgacttacaaggtgagtcggtcaataaattcaaccgtgcaacaattgaagatttc
aaagctgctatcgcggctgtaaaagctaataacgatattaaaggcttagttgttacctcg
ggcaaatctacatttattgttggtgcagatattaccgaatttggtcaaaactttgcacaa
ggcgaaaaagcgattgttgactggcttatgcctgttcacgaaatcttcaatagctttgaa
gatttagaccttccaaaagttgctgctattaacggcatggctttgggtggtggttttgaa
atgtgtttagtttgtgactatcgcgtgatgtcagaagctgcacaagtcggtttaccagaa
atcaaactcggtatttaccctggtttcggtggtagtgttcgtttaagccgtctcattggt
attgataatgcagttgaatggatggcaatggctactccaaagaaaccggctgctgcactt
aaagatggcgctgtagatgctgtggttgctgcggacaaattacttgacgctgctactgat
ctggttaagcaagcgatttctggtcgtttaaactggaaagcaaaacgccaagaaaaactt
gaagctgtaaaattgaacccacttgaacaaatgatggcgttcaacacagcaaaaggtgcg
gtacttgctaaagcaaatcctgctcaataccctgctccaaaattattacttgattcatta
caagctggtgcaagccttgcacgtgatgaagcgttaaaagctgaggctgaaggctttgcc
aaagcagccgtaactcctcaagctgaagcattaattggtttattcattaatgaccaagtt
gttaaaaaagcatctaagcaacatgaaaagggtgctcaccctgtaaaccaagctgctgta
cttggcgcgggtatcatgggtggtggtattgcttaccaagcggcaagcaaaggcactcca
atcatcatgaaagatattggtaacccacaacttgcattaggtatgaaagaagcaaacaac
ttgttaaccaagcaagttgaacgcaagaaaatgaaacctgcgcaaatgggtgaaacactt
gctcgcatccgtcctactttaagctacgaagagtttaaagaagttgacatcgtgatcgaa
gcggtaactgaaaatccaaaagtaaaagaaatcgtacttgctgaaactgagaaaaatgtt
cgtgaaaacacgatcattgcttctaacacctctactatttcaattacacggttagcaaaa
gcattacaacgtcctgaaaacttcgttggtatgcacttcttcaacccagttcacatgatg
ccacttgttgaagttattcgtggtgagaaaacttctgaagaagcaattgcaactacggtc
gtgcttgctcaaaaaatgggtaaaacaccaatcgttgtaaatgactgcccaggattcttg
gttaaccgtgtattgttcccttacttcggagcatttgaccttcttgtaaaagacggcgca
gatttccagcaaatcgacaatgtaatgtctaagttcggttggccaatgggtcctgcttat
ctgatcgatgttgtaggtatcgatacaggtgtacatggtgctgaagtgatggctgaaggt
ttccctgaccgtatgaagccagactacaaaggcgcgatcgaagcaatgtacgaagcgaag
cgtcttggtcaaaagaatgatgtaggtttctacaaatacgaactcgataagaaaggcaag
aaagcaaaaactgttgatccaacagcgtatgaagtaattgctccattcgtaactggcgaa
aaacgcgaatttgataaccaagaaattattgaccgtatgatgcttgctctttgcaatgaa
actgttcgttgcttagaagacaacattgtagcgactgcgtctgaggcagacatggcaatg
attatgggtattggtttccctccattccgtggtggtccatgccgttacatcgaccaaaca
ggtgttgctgaatacgttgcactttgcgacaaatatgcgcacttaggtaaggcttatgaa
gcgccacaaatgttgcgcgacatggctgctaacaacaaaaaattctacggttaa

DBGET integrated database retrieval system