KEGG   Acinetobacter baumannii D1279779: ABD1_08210
Entry
ABD1_08210        CDS       T02491                                 

Gene name
trxB
Definition
(GenBank) thioredoxin reductase
Organism
abad  Acinetobacter baumannii D1279779
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 FAD_oxidored FAD_binding_2 GIDA HI0933_like K_oxygenase NAD_binding_8 NAD_binding_7 Thi4 FMO-like Staph_opine_DH
Other DBs
NCBI-ProteinID: AGH34711
LinkDB
Position
complement(915580..916527)
AA seq 315 aa
MSARHSRLIILGSGPAGYSAAVYAARANLKPTLIAGLQLGGQLTTTTEVDNWPGDPEGLT
GPALMDRMQAHAERFGTELVYDHINEVDLNVRPFVLKGDMDEYTCDALIIATGATAQYLG
LESEQKFMGQGVSACATCDGFFYKNQNVMVVGGGNTAVEEALYLSNIAEHVTLVHRRDSL
RSEKILQDHLFAKEKEGKISIVWNHEVEEVLGDNTGVTGVRLKSTKDDSKQEVQVQGLFI
AIGHKPNTSMFEGQLNLRDGYIQVQSGTSGNATATSVAGVFAAGDVADSIYRQAITSAGS
GCMAALDAEKYLDNL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagtgctcgtcattctcggttaattattctcggttctggccctgcgggttatagtgca
gctgtttatgcagcacgtgcaaatcttaaaccaacacttattgcaggtttacagcttggc
ggccaacttacaacaacaaccgaagttgacaactggccgggcgatcctgaaggtttgact
ggtcctgccctaatggaccgtatgcaagcacatgctgaacgctttggtaccgaacttgtc
tatgaccatattaatgaagtggacttaaatgtacgtccttttgttcttaaaggtgatatg
gatgagtacacttgtgatgctttaattattgcaactggtgcgacagctcaatatcttggc
ttagagtctgaacaaaaatttatgggtcaaggcgtgagcgcatgtgcaacatgtgatggc
ttcttctacaagaaccaaaatgtgatggttgttggtggtggtaatactgctgttgaagaa
gcactttatttatcaaatattgctgaacatgtgacacttgtacaccgccgtgattcttta
cgctctgagaagattttacaagatcacttatttgctaaagaaaaagaaggcaaaatcagt
atcgtttggaaccatgaggttgaagaagttcttggtgacaatactggcgtaacaggtgtt
cgcttaaaatctacgaaagatgacagcaaacaagaagtacaagttcaaggcttattcatt
gcaattggccataaaccaaatacctctatgtttgaaggtcagctaaacttacgtgatggc
tatatccaagtacaaagtggtacttcaggtaacgcaacagcgacttctgtagcaggcgtt
tttgctgctggtgatgttgctgatagtatctatcgtcaagcgattacttcggcgggttca
ggctgtatggctgcactagatgccgaaaaatatctagataacctttaa

DBGET integrated database retrieval system