KEGG   Acinetobacter baumannii D1279779: ABD1_08510Help
Entry
ABD1_08510        CDS       T02491                                 

Definition
(GenBank) D-amino acid oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00730  Thiamine metabolism
abad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ABD1_08510
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     ABD1_08510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like NAD_binding_9 NAD_binding_8 GIDA Pyr_redox_2 Amino_oxidase Trp_halogenase FAD_binding_3 Thi4 Pyr_redox Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGH34741
LinkDB All DBs
Position
complement(947317..948432)
Genome map
AA seq 371 aa AA seqDB search
MHIAIIGAGISGLMSALELVEQGCTISIFDQQQAGQAASWAGGGILSPMYPWRYVHAVNQ
LAQFGKASYQAWNQKLYPVTGIDFEIHDTGMLIFDEEDFDIGLSYAEQHQEPMQRCEYLQ
RDALEQVNPHISEQFQEAIYFPELSNIRNPRVLQSLIRYLKQHPNVEFFEHTPVKKLIQQ
GDVIQALQTEDGRKHTADHFVITSGAWSHYWNSQLQLEIPVEPVQGQMLLFKTPAHWLPT
MCMNRVMYLIPRMDGHIVCGSSMAHRGFDTSTDETTQHNILEACLEMVPELADFPIVHRW
AGLRPSSPNGVPYIGKMPEMDNLWANFGHFRNGLCMGAGSAQLLRQLMLGQPTLVDAKAY
SPERLQNKILA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgcaatcattggcgcgggcataagtggattaatgtctgcgctggagttggtt
gaacaaggctgtaccatcagcatttttgatcaacaacaagcgggacaagcagcctcttgg
gctggtggaggtattctctctccgatgtacccgtggcgctatgtgcatgcagtgaaccaa
cttgcccaatttggcaaagcctcttatcaagcatggaaccaaaagctctaccctgttaca
gggattgattttgaaattcatgacacaggcatgctaatttttgatgaagaagattttgac
atcgggctttcctacgccgagcagcatcaagagccaatgcagcgctgtgaatatttacaa
agagatgccttagaacaagttaatccgcacatttccgaacaatttcaagaagcgatttat
ttccctgaactgtctaatattcgcaatccacgcgtattacagtccctgattcgctattta
aagcaacatccaaatgttgagtttttcgaacacactcctgttaaaaaactgattcaacaa
ggcgatgtgatacaagcgctccaaaccgaagatggtcgcaaacatacagcagaccatttt
gtaataacttcgggcgcttggagccattactggaactcacaattacaactcgaaattcca
gtcgaacctgttcaaggtcaaatgctgttatttaaaacccctgctcactggctaccgacc
atgtgtatgaatcgagtcatgtatttgattccacgtatggacggtcatattgtgtgcggg
tcaagcatggcacatcgtggttttgacacctctaccgatgaaacgactcagcacaatatt
ttagaagcgtgtttagaaatggtgcctgaactggccgatttcccgattgtacatcgctgg
gcaggacttagaccaagttcaccaaatggcgttccatacattggcaaaatgcctgaaatg
gataacctctgggcaaactttggtcattttagaaatggtttgtgtatgggcgcaggttct
gcacaattgcttcgtcagcttatgctaggtcaaccaacattagttgatgccaaagcatat
tcaccagagcgcttgcaaaataaaatcttagcctga

DBGET integrated database retrieval system