KEGG   Acinetobacter baumannii D1279779: ABD1_13360
Entry
ABD1_13360        CDS       T02491                                 

Definition
(GenBank) hypothetical protein
  KO
K21061  D-hydroxyproline dehydrogenase subunit beta [EC:1.5.99.-]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00330  Arginine and proline metabolism
abad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ABD1_13360
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     ABD1_13360
SSDB
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 FAD_oxidored Pyr_redox_2 Thi4 3HCDH_N Lycopene_cycl NAD_binding_9 GIDA FAD_binding_3 ApbA Pyr_redox HI0933_like AlaDh_PNT_C Pyr_redox_3
Other DBs
NCBI-ProteinID: AGH35224
LinkDB
Position
1434628..1435731
AA seq 367 aa
MRTDAIVIGAGIVGAACAYELARQGLNVQVLDARIGGATAAGMGHLVIMDDLEAELKLSH
WSVQLWHELGHELSEDCAYRQTPTLWLASSSEEMQIAEEKYQRLTAQGVRCQLRNADEVR
QLEPHLKQGLYGGLEVFDDGILYAPCAAEWLLKKFPHKVQVQQTKVIHIEENRVQLSDGT
WLEAAHIVLANGIHATDFFPELPIEPKKGHLAITDRYPKLNVKHTLVALAYAASTQATSG
ISVACNIQPRPTGQLFIGSSRQFNTVDPTVEPEVFTRVLKEAADYFPALADLNVIRAWTG
FRAATPDGIPVIGRHPAFQSVYLAVGHEGLGVTTATGTAKLIASHICGLTFDIDPEPFLP
HRFIGAA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagaaccgatgccatcgtcattggggcaggcattgtaggtgcggcatgtgcttatgaa
ttggctcggcaagggttaaatgtgcaagttttggatgctcggatcggtggtgccacagcc
gcgggcatggggcatttggtcattatggatgacttggaagccgaattaaaacttagtcat
tggtcagttcagctatggcatgaattaggacacgaactttcggaagactgtgcctatcgc
caaacgccaactttatggctggcaagtagctcagaagaaatgcagattgctgaggaaaaa
tatcaacgtctcactgcacaaggtgtccgttgccaacttcgaaacgcagatgaagttcgt
cagcttgaacctcacttaaagcagggtctttatggtggtttagaagtttttgatgatgga
attttatatgcaccttgtgctgctgaatggttattaaaaaaatttccccacaaggttcag
gttcaacaaactaaagttattcatattgaagaaaatcgggttcagttaagtgatggcaca
tggctagaagctgcacatatcgttttggctaacggtattcatgcgacagatttttttcca
gagctaccgattgaacctaaaaaaggtcatttggcgattactgatcgttaccctaaatta
aatgtaaaacatacgttggtggctttggcttatgcggccagcactcaagcgacaagtgga
atttcggtggcttgtaatattcagcctagaccgacgggccagctttttattgggtcatct
cgtcagtttaatacagtagatccaactgtagagccagaagtctttactcgggtacttaaa
gaggctgcggattattttccagctttggctgatcttaatgttattcgggcatggactggc
tttcgcgcagccacacccgatggtattccggtaattggacgtcatcctgcatttcaatcg
gtttatttagcggtagggcatgaaggtttaggtgtaaccacagcaacaggtacagcaaaa
ctgattgcctcacacatatgtggattaacttttgatatagatccagaaccttttttacct
catcgttttataggagctgcatag

DBGET integrated database retrieval system