KEGG   Acinetobacter baumannii D1279779: ABD1_13380
Entry
ABD1_13380        CDS       T02491                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00330  Arginine and proline metabolism
abad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ABD1_13380
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     ABD1_13380
SSDB
Motif
Pfam: Pyr_redox_2 FAD_binding_2 FAD_oxidored HI0933_like Thi4 GIDA DAO NAD_binding_8 AlaDh_PNT_C Pyr_redox_3 FAD_binding_3 NAD_binding_9 Pyr_redox K_oxygenase Lycopene_cycl
Other DBs
NCBI-ProteinID: AGH35226
LinkDB
Position
1435962..1437224
AA seq 420 aa
MEKQYDVVVVGAGPAGLSAAIAAAESGGRILILDNNPQAGGQIWRAGPIFPVPEMAQQKY
QQIKAHSNIEFMFGAKIVAAPFAGQLLVERPHDSLNLSYHQLILCTGARELFLPFPGWTL
PGVTGAGGLQALIKAGTPVKNERIVIAGSGPLLLASADTAKKAEAQVLYVAEQAASSSVR
KFALQLWRWPSKIIQALSLPYRLYQPDSYVVEAIGQERLERVRLQTPKGIIEIECDRLAC
GFGLVPNTQLGQLMGCQIKDNAITVDDYQRTSQPQVWAAGECTGFGGSELAMVEGSIAGY
AAIGQNEKARQLFAQRQRYRLFAHLLEKSFKLRAELKTLARPETIFCRCEDVTFDKVAER
NSWIDAKLHTRCGMGACQGSTCATAAACLFDWQLPNSRPPLLPTRVKSLMAMSTSPLNQK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggaaaaacaatacgatgtggtggttgtcggtgctgggcctgcagggttgtcagctgct
attgcagccgccgaaagtggcgggcgaattttaatattggataataacccacaggcgggt
ggtcaaatctggcgggctggaccgatttttcctgtacctgaaatggcgcagcagaaatat
caacaaattaaggctcattctaatattgaatttatgtttggtgcgaaaattgtcgccgcc
ccttttgcaggccaattgcttgttgagcgacctcacgacagcctaaacttgtcttatcat
cagcttatattgtgtacgggtgcaagagaactgtttttgccttttcccggttggacttta
cctggcgtaacaggggcaggtggtttgcaagccttaattaaagcaggcacacctgtcaaa
aatgaacgcattgtgattgcaggttcagggccattacttttagcaagtgcggatacggca
aaaaaagcagaggctcaagttctctatgttgccgaacaggcggcttcatcttccgttcgt
aagtttgcactacaactttggcgttggccttcgaaaataatacaggcgttatctttgcct
tatcgtttatatcaacctgacagttatgtggttgaggcgattggtcaggagcgtcttgaa
cgggtaaggctacaaacgccgaagggaatcattgaaattgagtgtgatcgactcgcgtgc
ggatttggtttagtcccgaatactcaattagggcagttaatgggttgtcaaattaaggac
aatgcgattacggtcgatgactatcaacgtacatcacagccacaggtgtgggcagcaggt
gagtgtacaggttttggcggaagtgagctggcgatggttgaaggtagcatcgcaggttat
gccgctataggccaaaatgaaaaagcgagacaattatttgctcaaagacaacggtatcgt
ttatttgcacatctccttgagaaaagctttaagttacgtgctgagttaaaaacgcttgca
cgcccagaaactattttttgtcgatgtgaagatgtaacttttgataaagttgccgagcgt
aatagttggattgatgcaaaattacatacacgctgtggaatgggggcgtgccaaggaagc
acatgtgcaacagcagcggcctgcctgtttgattggcagttgcctaactctagaccacca
ttactgcctactcgtgtaaaaagcctcatggcgatgtctacttctcctttaaatcaaaaa
tga

DBGET integrated database retrieval system