KEGG   Acinetobacter baumannii D1279779: ABD1_16940Help
Entry
ABD1_16940        CDS       T02491                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00010  Glycolysis / Gluconeogenesis
abad00020  Citrate cycle (TCA cycle)
abad00620  Pyruvate metabolism
abad01100  Metabolic pathways
abad01110  Biosynthesis of secondary metabolites
abad01120  Microbial metabolism in diverse environments
abad01130  Biosynthesis of antibiotics
abad01200  Carbon metabolism
Module
abad_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABD1_16940 (acoC)
   00020 Citrate cycle (TCA cycle)
    ABD1_16940 (acoC)
   00620 Pyruvate metabolism
    ABD1_16940 (acoC)
Enzymes [BR:abad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABD1_16940 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGH35579
LinkDB All DBs
Position
1810996..1812480
Genome map
AA seq 494 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADSEVSDAEIEKFIASLGGSAAQAPSEQSKAETSAPIAEKAEQPQTVAASASAPAKV
AKGDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQA
AGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDV
EAVYYRNNPTSVNEQSAQCAVAQPQSTITTVAMNGMRKAIASRLQTAKRNAPHFRLVVDL
NVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADI
SVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGML
GIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLA
SFKQFVENPALILV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataagggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttggtggtcttatt
gccgtatgtgctgatagtgaagtttctgatgcagaaattgaaaagtttatcgcatcatta
ggtggttcagcagctcaagcaccttcggaacaaagtaaagcggaaacatctgcacctatt
gctgaaaaagcagaacagccacagactgtagcagctagtgcttcagctcctgcaaaggtc
gctaaaggtgactacgctgtaccagagtcattacaaggctatcaaacatctaatgagttg
tttgcaacgccgcatgccttgaagcttgcagaaaaacacaatgtaaacttggcaaaagtc
acaggttctggtcgtgaaggacgtattagtgttcaagacatccagaaggcggtacaagct
gctggtggtcaatggcctgatgttaagcagcaaactcaagctaaagtagttaaatctacg
gccgatgatagccaagttttagcaacgcctgtagcacgtcgtttagcaaagcaatggggc
attaacctaaatgactgccgtgtttcaggtactcgtggccgtgtctgtaaagaagatgtt
gaggcagtttactatcgtaataacccaacgtcggtaaatgaacaatctgctcaatgtgct
gttgctcaaccacaatctacaattacgactgtggcgatgaatgggatgcgtaaagcgatt
gcttcacgcttacagactgcaaaacgtaatgcaccgcatttccgcttagtggtcgatctc
aacgtagaggctttgcaaaaactacgtaagcagattaatgagactgttccacaagtgaaa
ctttctattaatgacatgctaattaaagcagctgctgcggcactgattaaagtacctgaa
gtgaatgttcaatttgatgaggcgactcaatcaattttacagttctctcaagcggatatt
tcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagcaaatcag
aagtctttagcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaagactggc
aagttacaacctgatgagtttcaagggggcagctttagcatttcaaatttaggaatgtta
ggcattaaacagttcgatgccattattaacccaccgcaaggtgcaattatggcattaggt
gcttcggaatctcgcgctgttgtcgaaaatggcaatgtagtggttcgtgagattgtcaca
gcgacgttgtcatgcgatcaccgagttattgatggtgcagttggggcgaaattcttggcc
agctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system