KEGG   Acinetobacter baumannii D1279779: ABD1_17020Help
Entry
ABD1_17020        CDS       T02491                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
abad  Acinetobacter baumannii D1279779
Brite
KEGG Orthology (KO) [BR:abad00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ABD1_17020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AGH35587
LinkDB All DBs
Position
1820899..1821690
Genome map
AA seq 263 aa AA seqDB search
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEG
LFKKIVRYRAAIWIALIGAPMAHIGILIANTISPIWLMLMFSLVMFTVGYRLISNRVSDF
HNPPCQVNPSTGRFIWNFKTGGVLASIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHS
IVATSLMIIFLISGMSIVMHIAEGFHYPVAITSAFALACAFGMLLGRRAIRFIPSVIVQK
VFALMVFAVAIYMVIKIVNLTNI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttattacttgtcgttgaaggcattgtgattggctttttacttggtcttactggtgcg
ggtggtggcattcttgctgtacccgcgcttatgaccagtcaaggctggagcgtggcgcaa
gctgcgccaattgggttattggcagttgcgctatctacactcattggaactattgaaggc
ttatttaaaaagatagttcgttatcgtgctgcaatctggattgccttaattggtgctcct
atggcacatatcggcattttaatagctaacacgatttcacctatttggctcatgttaatg
tttagcttggtcatgtttacagtgggctatcgacttatcagtaaccgagtttcagatttt
cataacccgccgtgtcaggtcaacccaagtacgggacgctttatctggaattttaaaact
ggtggtgtgcttgcaagcatcgggattattgctgggcttttaacggggatgttaggggtt
ggaggcggctttgtaattgtacccgcgcttagaaaagtcacaaatttggatatgcatagc
attgttgcaacctcacttatgattattttcctgattagtggcatgagtattgtgatgcat
attgcagagggctttcactatccagtcgccattactagtgcgtttgcactcgcatgtgca
ttcggtatgttattaggacgccgagctattcggtttattccgtctgtaattgtacaaaag
gtctttgctttaatggtttttgctgtcgcaatttatatggttattaagattgttaatcta
acaaatatctga

DBGET integrated database retrieval system