KEGG   Acinetobacter baumannii D1279779: ABD1_17040Help
Entry
ABD1_17040        CDS       T02491                                 

Definition
(GenBank) DMT superfamily permease
Organism
abad  Acinetobacter baumannii D1279779
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA Deltameth_res
Motif
Other DBs
NCBI-ProteinID: AGH35589
LinkDB All DBs
Position
complement(1822837..1823754)
Genome map
AA seq 305 aa AA seqDB search
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALK
DHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFA
PAALLGLSGIVLLFWHDLINSQFNAQLLMGIGLCAIGTYGFSLGNMISVRHQKRGLNIFS
TNCYAMTYGALVMLILALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGA
AKAAYSTLLFPLVALTVSTFFEGYEWTLNAVFGILLILLGNYLMFSKFEIGKKLFSSQKN
CEKQA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttactctatgttgcggtggtgttgatttggggaacaacatggattggaatt
gccgttcaaagccactatgcaacacccgttgtcgcaattttatggcgttttgccatttca
gccttattactttgggtggttttactattttcaggaaaattacagcgaattgctttaaaa
gatcacttgttctgtatgctgcaaggactttgtgtttttggcctaaactttatttgtttt
tatactgcggttaaatatgtaaatagcggtttagagtctgtcattttttcgatggcggtt
ttctttaatgccattaatgcacttatcttttttaagcagaaaccttccccaaactttgcg
ccagctgcacttttgggcctaagtggtattgttttactattttggcacgatctgattaat
agccagtttaatgcgcagttattaatgggtattgggctatgtgcaataggcacttacggt
ttttctttagggaatatgattagtgttagacaccaaaaacgtggcctaaatatcttttca
acaaactgttatgccatgacttatggcgcattggtgatgttaattctggctttatttaca
ggacaagatttaatgccgccgatgaatttcccatttttaagctcggtactatacttagct
gtatttggcacggttattgggttttcagcttatttttctctggtcggacgaattggcgca
gctaaagcagcctatagcacgttgctctttcctttggttgctctaacagtttctactttc
tttgaaggatatgagtggactttaaatgctgtatttggaattttactcatcttacttggt
aactacttaatgtttagtaagtttgaaattggaaagaagttatttagcagtcaaaaaaat
tgtgagaagcaggcataa

DBGET integrated database retrieval system