KEGG   Acinetobacter baumannii D1279779: ABD1_21800
Entry
ABD1_21800        CDS       T02491                                 

Gene name
gidA
Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification enzyme
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
abad  Acinetobacter baumannii D1279779
Brite
KEGG Orthology (KO) [BR:abad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abad03016]
    ABD1_21800 (gidA)
   03036 Chromosome and associated proteins [BR:abad03036]
    ABD1_21800 (gidA)
Transfer RNA biogenesis [BR:abad03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ABD1_21800 (gidA)
 Prokaryotic type
    ABD1_21800 (gidA)
Chromosome and associated proteins [BR:abad03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ABD1_21800 (gidA)
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored Pyr_redox_2 FAD_binding_2 DAO HI0933_like AlaDh_PNT_C Pyr_redox Thi4 Pyr_redox_3 NAD_binding_9
Other DBs
NCBI-ProteinID: AGH36065
LinkDB
Position
complement(2359283..2361163)
AA seq 626 aa
MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMSCNPAIGGIGKSHLV
REIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRVRYKAAIRETLENQANLDI
FQQAADDLIVEGDTVKGVVTQMGIRFDAKTVVLTTGTFLGGVIHVGLEKSSGGRAGDPPS
IALAQRLRELKLPVGRLKTGTPPRIDARSVDFSVMTPQPGDFPSPVMSFMGDVSMHPEQV
NCYITHTNEKTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFSDKDSHQVFLEPE
GLDTHELYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIEYDYFNPQALKFTLETK
AINGLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWEQEEWTPKRDQAYMGVLVDDLITL
GTKEPYRMFTSRAEYRLMLREDNADQRLTTIGRELGLVDDVRWAAYCEKMEAVERETSRL
QHLWAAPNNPMGKKFVEMTGADLSKECSAIDLLKRPNINFGQIAELTGSEVSQQVGEQIE
IAVKYEGYINRQHEDVAQLKRLEETKIPADFDYDVVSGLSREITQKLKTVRPETLAQASR
IPGVTPAAVQLVMITIRKNNMTKKTA
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgcactatcctaaagtttatgatgttatcgttatcggtggcggtcacgcaggtacggaa
gcggcgcttgctgctgcgcgtatgggacgacagactttgcttttgacccataacattgag
actttgggtcagatgagctgtaacccagcaattggtggcattggtaagtcgcacttagtt
cgtgaaattgatgcgcttggcggtgcaatggctttagctgccgataaaggcggtattcaa
ttccgtattttaaactcgcgtaaaggtgcagcagtacgtgcaacgcgtgctcaggctgac
cgtgttcgctataaagctgcgattcgtgagaccttagaaaaccaagcaaatcttgatatt
ttccaacaggcggctgatgacctgattgttgaaggcgatacagttaagggtgttgtgacc
caaatgggtatccgctttgatgcaaaaactgttgtgttaactactggtacattcttgggc
ggtgttattcacgttggtttagagaaatcaagcggcggtcgtgctggtgatcctccttct
attgctcttgctcagcgtcttcgtgaattgaaattaccggtaggccgtttaaaaacaggt
acacctccacgtattgatgcacgttcagttgatttttcagttatgacaccacaaccaggc
gacttcccgtctccggtaatgtcgttcatgggtgatgtgtctatgcacccagaacaagtg
aattgctatatcacgcatactaacgaaaaaactcatgacattattcgtggtggcttagac
cgttcaccaatgtataccggtgttattgaaggggtaggtccacgttactgtccttcaatt
gaagataagattcatcgtttctctgataaagactcgcatcaggtattcttagagccagaa
ggccttgatacacatgagctttatccaaatggtatttcgacttcattaccatttgatgtt
cagtttgaacttgtgcgctcgattcgcggtatggaaaatgcccatatcttacgtccgggt
tatgcaatcgaatatgactatttcaacccgcaagctttgaaatttaccctagaaactaaa
gcaattaacggcttgtattttgcagggcaaattaatggtactaccggttatgaagaagct
ggtgcccaaggtttacttgcaggcttgaatgctgcacgccgtgcatgggaacaagaagaa
tggacacctaaacgtgaccaagcttatatgggtgtattggttgacgacttgattacttta
ggtacgaaagagccataccgtatgttcacttcacgtgcggaatatcgtttgatgttacgt
gaagataatgccgatcaacgtttaacaactattggtcgtgagcttggtttggttgatgat
gttcgttgggcggcttattgcgaaaaaatggaagcagttgagcgcgaaacatcacgtcta
caacatttatgggcggcacctaacaacccaatgggtaaaaagtttgttgaaatgacaggt
gctgacttaagtaaagaatgtagtgcgattgacttgcttaaacgtcctaatattaatttt
ggccaaattgcggaacttacaggttctgaagtatcacagcaagtcggtgagcaaattgaa
attgctgttaaatatgaaggttatatcaaccgtcagcatgaagatgtggctcaattaaaa
cgtcttgaagaaactaaaattcctgctgattttgattatgacgtcgtttcaggtttatct
cgcgaaattactcagaagttgaaaacagttcgcccggaaacattagctcaagcgagccgt
attcctggtgttaccccagctgctgttcagcttgtaatgatcacgattcgtaaaaataat
atgacgaaaaaaacggcttaa

DBGET integrated database retrieval system