KEGG   Acinetobacter baumannii D1279779: ABD1_26510
Entry
ABD1_26510        CDS       T02491                                 

Gene name
lpd
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00010  Glycolysis / Gluconeogenesis
abad00020  Citrate cycle (TCA cycle)
abad00260  Glycine, serine and threonine metabolism
abad00280  Valine, leucine and isoleucine degradation
abad00310  Lysine degradation
abad00380  Tryptophan metabolism
abad00620  Pyruvate metabolism
abad00630  Glyoxylate and dicarboxylate metabolism
abad00640  Propanoate metabolism
abad01100  Metabolic pathways
abad01110  Biosynthesis of secondary metabolites
abad01120  Microbial metabolism in diverse environments
abad01200  Carbon metabolism
Module
abad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abad_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABD1_26510 (lpd)
   00020 Citrate cycle (TCA cycle)
    ABD1_26510 (lpd)
   00620 Pyruvate metabolism
    ABD1_26510 (lpd)
   00630 Glyoxylate and dicarboxylate metabolism
    ABD1_26510 (lpd)
   00640 Propanoate metabolism
    ABD1_26510 (lpd)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABD1_26510 (lpd)
   00280 Valine, leucine and isoleucine degradation
    ABD1_26510 (lpd)
   00310 Lysine degradation
    ABD1_26510 (lpd)
   00380 Tryptophan metabolism
    ABD1_26510 (lpd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abad04147]
    ABD1_26510 (lpd)
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ABD1_26510 (lpd)
Exosome [BR:abad04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ABD1_26510 (lpd)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA AlaDh_PNT_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_3 3HCDH_N DAO Thi4 FAD_binding_3 2-Hacid_dh_C Lycopene_cycl
Other DBs
NCBI-ProteinID: AGH36535
LinkDB
Structure
PDB: 
6BZ0

Position
complement(2887139..2888572)
AA seq 477 aa
MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALL
DSSHRYEDTVHHLADHGITTGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGT
GKLLAGKKVEFVPHEGETQILEPKYVILASGSVPVNIPVAPVDQDIIVDSTGALNFPEVP
KRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILTKQGLDIRI
GAKVSGTEVNGREVTVKYTQAGEDKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLV
EVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHP
EAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIG
PAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAIQRKRK
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtctcaacaatttgatcttgttgtcattggcggtggtcctggtggttatgaagctgcg
attcgcgctgctcaactaggcttcaaagtcgcttgtattgaaaaacgtattcacaacggt
aagccttctttaggtggtacttgcttaaacgtaggttgtatcccttctaaagctttgctt
gattcttctcatcgttatgaagatacagtgcatcatttagctgatcacggtattacaact
ggtgaagtgaatttcgatcttgcaaaacttcttgctcgtaaagacaaaattgttgaccaa
ttaactggcggtattgatcaattgcttaaaggcaacggtatcgagtggttaaaaggtaca
ggtaaattacttgctggtaaaaaagttgagtttgttccacatgaaggtgaaactcaaatt
ttagaacctaaatacgtaattcttgcgtctggttctgtgcctgtaaatattcctgtagct
cctgtagatcaagatattattgttgattcaactggcgcattaaacttccctgaagtacct
aagcgtttaggtgtaattggtgcaggtgtaatcggtttagaacttggttcagtatggcgt
cgtcttggtgcagaagttgttgtatttgaagcaatggatgcattcttgccaatggctgat
aaagcactttctaaggaatatcaaaaaatcttgactaaacaaggtttagatatccgcatt
ggtgcaaaagtatctggtactgaagtaaacggtcgtgaagtgactgttaaatacactcaa
gctggtgaagacaaagaacaaacgtttgataagttaatcgtttgtgttggccgtaaagct
tatgctgaaggtttattagctgaagattcaggtattaaattaactgaacgtggtttagtt
gaagtaaatgatcactgtgcaacttctgtagaaggtgtatatgcgattggtgacttagtg
cgcggtccaatgcttgctcataaagcaatggaagagggcgtaatggctgttgaacgtatc
cacggtcatgcagctcaagtaaactatgacacaatcatttctgttatctatacacaccct
gaagcggcgtgggttggtttaactgaagagcaagctaaagaaaaaggtcatgaagtaaaa
actggtcaattcggttttgctgtaaatggtcgtgctttagctgctggtgaaggtgcaggt
tttgttaagtttgttgctgatgcaaaaactgaccgtttattaggtatgcatgtgattggg
cctgcggcatctgatatcgttcaccaaggtatgatcgcacttgaatttgtatcttctgtt
gaagatcttcagttgatgacttttggtcacccaacattctctgaagttgttcatgaagct
gcacttgctgtagatggtcgtgcaattcacgcgattcaacgtaagcgtaaataa

DBGET integrated database retrieval system