KEGG   Acinetobacter baumannii D1279779: ABD1_32300Help
Entry
ABD1_32300        CDS       T02491                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
abad00473  D-Alanine metabolism
abad00550  Peptidoglycan biosynthesis
abad01100  Metabolic pathways
abad01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABD1_32300 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABD1_32300 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ABD1_32300 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abad01011]
    ABD1_32300 (ddl)
Enzymes [BR:abad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABD1_32300 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:abad01011]
 Precursor biosynthesis
  Amino acid ligase
   ABD1_32300 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AGH37112
LinkDB All DBs
Structure
PDB: 

Position
complement(3521866..3522792)
Genome map
AA seq 308 aa AA seqDB search
MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDR
AFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRII
TKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWIT
GREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRNDVEYGIPCGLSETEEKKLQALCL
RAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAIL
EQTLEGTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatgctacaaaattcggcaaagttgccgtgttacttggtgggaaatcggctgag
cgtgctgtgtctttagatagtggtcaggcagttttggacgccttgttacgttcaggtgtt
caggctgaggcatttgatccgcaagaccgtagcgtgactgaacttgtaaactatgaccgt
gcatttattgtattgcatggtcgtggtggtgaagacggtcaaatccaaggtgtgcttgag
tggttgaacatcccttatacaggaacgggtgtacaaggttctgccattggtatggataaa
gtcaaaaccaagcaaatctggcaaggtagtgatttaccaaccgcaccgtatcgcattatt
actaaagaaactgacttggattcagtgattgctgaattggggttgcctgtcattatcaag
cctgtacatgaaggttcaagtgtaggcatgagtaaggttgagaaagctgaagattttgcg
gcagcaattgaaaaggcaactcagcacgatgctgtagttatggcagaaaaatggattaca
ggacgcgaatttacgatttcattcttaaatggtcagcctttaccagttattcgtttgcag
ccaccagcagatgttgctttctatgactacgaagcaaaatatcaacgtaatgatgttgag
tatggcattccttgtggtcttagcgaaactgaagagaaaaaactacaagctctatgttta
cgcgctttccaagccgtaggtgcagaaggctggggacgtattgatgcaatgcaggatgag
caaggtaatttctggcttttagaagtaaatactgtgccaggcatgaccagccattcgctt
gtaccaaaggctgctaaagcagtgggttatagctttgatgaattgtgtgttgcaattctt
gagcaaacattggaaggtacggcttaa

DBGET integrated database retrieval system